SecReT6
Protein ID: 197248637
SecReT6 ID298
T6SS typei1
Gene symbol-
Locus tagSeAg_B1095
StrainSalmonella enterica subsp. enterica serovar Agona str. SL483
Repliconchromosome [GenBank: NC_011149] [Browse all T6SS(s) in this replicon]
Location [Strand]1091793..1092053 [-]
ProductPmt1
NoteTssM
UniProt IDB5F217
KEGG IDsea:SeAg_B1095
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 86 a.a.     [Download]
>gi|197248637|ref|YP_002146003.1| Pmt1 [Salmonella enterica subsp. enterica serovar Agona str. SL483]
MREGNESKRALIGVSGGAPRSISFSGPWAQFRLFGAGQLTGVQEGTFSVRFNVDGGAMVYRVHTDTEDNP
FTGGLFSQFRLPDTLY
 
Nucleotide Sequence: 261 bp     [Download]
>gi|197247352|ref|NC_011149.1|:c1092053-1091793 Salmonella enterica subsp. enterica serovar Agona str. SL483 chromosome, complete genome
ATGCGTGAAGGCAATGAAAGTAAGCGGGCGCTGATAGGCGTCAGTGGCGGCGCGCCGCGCAGCATCAGTT
TCAGCGGGCCGTGGGCACAGTTCAGGCTGTTCGGCGCCGGGCAACTTACCGGCGTTCAGGAGGGGACATT
CAGCGTGCGCTTTAACGTGGACGGCGGAGCGATGGTGTACCGGGTACATACCGATACGGAAGATAACCCC
TTCACCGGCGGGCTGTTCAGTCAGTTCCGGCTGCCGGATACCCTGTACTGA
 Primer design