SecReT6
Protein ID: 197284630
SecReT6 ID272
T6SS typei1
Gene symbol-
Locus tagPMI0736
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T6SS(s) in this replicon]
Location [Strand]811475..815023 [-]
Producthypothetical protein
NoteTssM
UniProt IDB4ET48
KEGG IDpmr:PMI0736
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.10E-80, Aligned region: 212..248
IcmF-related [PF06761], Evalue: 4.10E-80, Aligned region: 514..827
ImcF-related_N [PF14331], Evalue: 2.40E-66, Aligned region: 211..467
ImcF-related_N [PF14331], Evalue: 2.40E-66, Aligned region: 767..807
ImcF-related_N [PF14331], Evalue: 2.40E-66, Aligned region: 908..941
DUF1215 [PF06744], Evalue: 2.40E-34, Aligned region: 311..329
DUF1215 [PF06744], Evalue: 2.40E-34, Aligned region: 604..630
DUF1215 [PF06744], Evalue: 2.40E-34, Aligned region: 722..738
DUF1215 [PF06744], Evalue: 2.40E-34, Aligned region: 749..788
DUF1215 [PF06744], Evalue: 2.40E-34, Aligned region: 921..1040
Protein Sequence: 1182 a.a.     [Download]
>gi|197284630|ref|YP_002150502.1| hypothetical protein PMI0736 [Proteus mirabilis HI4320]
MKLPVFSISNITSSVKKLFFADKSKIASFLLFLLALLPALLIIWIWWWGPTFRYQDSIPFSEVTTRWLAT
VVIVLLVVSWIGLATWRRVKKLEALKLDVELAVVDPVRQDLDFQKRYLNYWKSQFIRHLNGHTKAVYLRP
WYFVLGANQSGKHSLLKNTVNPLDIAPSDNIVNEQNIALNIQCLLTDNAVLFVPNGDLLTQPANQADKPQ
LYHRLWGDLLNWIKTNRPRQPMNGIVLTVDTLSLLTNSKEQNSQLLADLQMRIEEIRMTFNSRLPLYIVL
TKLDLLRGFDSMYQSLDVQQRNEVLGVSFNQKAKSNWKKELNHFWSQWVGQMNSALPEMMLQRAEGNQRS
DLFSFVRQIEGLQHSVCTLIDALLINNEQHNICLRGVYLTSALQIGQIDDVFSQTASEQYHLPTAPLTTW
PINDSHPYFTTQLFSQVLFSEPNIAAENHYWVKKHRTRLLVTTAVSFVGLIAIWNGWSHYYDKNYRAGEN
VLNEVKAFRAIENNAQKDTDGSLQLPVLNPLREATLAYGNHRDKNVLFSDMGLYQGQKVGPQVEQVYLQL
LTDRFLPAVMSGLLNELNSADKGSEDKLEILRIMRMLEDKSGRNNGMVEDFMADYWSQLFTGQREKQLQL
KAHLRYALEHTDWKQEREKGFVSATKAFMPFAGPIKNAQAELSVLSLYQRVYQALRLKANQELSAPLNLQ
HQIGPSFNTVFTAIDDDKLEIPQFLTRSGLLNYFIRQNDKLVELTLLDAWVLNLTTNTQYSESDRKEIQR
QISEQYLSDYTAQWRNAMSNLEIRQFDSIQDEITALEQIISGEQPLRRALQVLRDNTVIPTIDENLPLDE
QKTLMAEPSYRLLTRLDREFTPQTEILVSNQGENLQNLNQKLNDLHRYLLGIQNSPVPGKAALKAVSMRL
NDNNRDAIFELSQMAKTLPEPLNRWVDELSVQAWNVVQKEAIRYMEVEWNENVVKQYNTYIAGRYPFNPA
AKQDVPLSEFERFFKPNGTLDSFYQQNLRLFVENNLVNDSDSQSLIRADVLAQIEIANRIRETFFNAQGN
LEAQYAIEPLSLSGNKRRSILNLDGQLIDYAHSRSHVTHLVWPNSMRSNIESKLTLVPLSGDKSPRSISF
SGPWAQMRLVDNAKLINIKSNSFDIRFTIDGGDMTYRVIVDESNNPFFGGLFTKFRLPETLY
 
Nucleotide Sequence: 3549 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c815023-811475 Proteus mirabilis HI4320 chromosome, complete genome
ATGAAATTACCGGTTTTCTCCATTTCAAACATTACGAGTTCGGTAAAAAAACTCTTTTTTGCTGATAAAT
CTAAAATTGCCTCCTTTTTGCTATTTTTATTGGCATTACTTCCCGCTTTGCTCATTATTTGGATCTGGTG
GTGGGGGCCAACATTTCGTTATCAAGATTCCATACCGTTTAGCGAGGTCACCACACGTTGGTTAGCAACC
GTCGTTATTGTATTGCTTGTTGTGAGTTGGATTGGTCTAGCAACATGGCGTCGAGTTAAAAAATTGGAAG
CATTAAAACTTGATGTCGAATTGGCTGTAGTTGATCCGGTAAGACAAGATCTTGATTTTCAAAAACGTTA
TTTAAACTATTGGAAATCACAATTTATTCGCCACTTAAATGGTCATACTAAAGCGGTTTATTTACGCCCT
TGGTATTTTGTTTTAGGTGCTAACCAAAGTGGAAAGCATAGCTTATTAAAAAATACGGTAAACCCATTAG
ATATTGCGCCTAGCGACAATATTGTTAACGAACAAAATATTGCATTAAATATTCAATGTCTATTAACCGA
CAATGCTGTACTTTTTGTCCCTAATGGTGATCTATTAACCCAGCCGGCAAATCAGGCTGATAAACCTCAA
CTTTATCACCGTTTGTGGGGCGATTTACTCAATTGGATCAAAACTAATCGCCCAAGACAACCAATGAATG
GCATCGTCTTAACTGTCGATACCCTATCGTTATTAACCAATAGTAAGGAGCAAAATAGTCAGCTACTTGC
TGATTTACAAATGCGTATTGAAGAAATACGCATGACATTTAATAGTCGCTTGCCTTTATATATCGTCTTA
ACCAAGCTAGATCTATTACGTGGTTTTGACTCAATGTATCAATCATTAGATGTTCAACAACGTAATGAAG
TACTAGGTGTTTCTTTCAACCAGAAAGCAAAAAGTAATTGGAAAAAGGAATTAAATCATTTTTGGTCACA
ATGGGTAGGCCAAATGAACAGCGCATTACCAGAAATGATGCTACAAAGAGCAGAAGGTAACCAGCGTAGT
GATCTATTTAGTTTCGTGCGCCAAATTGAAGGGTTACAACATTCTGTATGCACATTAATTGATGCATTGC
TCATCAATAATGAGCAACATAATATCTGTTTAAGAGGGGTTTATTTAACTTCTGCATTGCAAATCGGTCA
AATCGATGATGTGTTTAGCCAAACAGCGTCCGAACAATATCATTTACCGACAGCACCTCTTACTACATGG
CCAATTAATGATAGCCACCCTTATTTTACTACCCAATTATTTAGTCAAGTGCTATTTAGTGAGCCTAATA
TTGCAGCAGAAAACCATTATTGGGTTAAAAAACATCGGACTCGCCTATTAGTCACCACTGCTGTTAGCTT
TGTCGGCTTAATCGCAATTTGGAATGGTTGGAGCCACTATTACGACAAAAACTATCGTGCTGGAGAAAAC
GTTCTTAATGAGGTAAAAGCATTCCGTGCTATTGAGAACAATGCTCAGAAAGATACTGATGGTAGCCTAC
AATTACCGGTGCTCAATCCATTACGTGAAGCAACCTTAGCTTATGGTAATCATCGTGATAAAAATGTGCT
CTTTTCTGATATGGGTCTTTACCAAGGTCAAAAAGTTGGCCCACAAGTTGAACAAGTCTATTTACAACTA
CTCACCGATCGTTTTTTACCTGCGGTTATGTCTGGGTTGTTAAATGAACTTAACAGTGCCGACAAAGGAA
GTGAAGATAAGTTAGAGATATTGCGTATTATGCGCATGTTAGAAGATAAAAGTGGCCGTAATAATGGCAT
GGTAGAAGATTTTATGGCCGATTATTGGAGCCAACTGTTCACTGGTCAACGTGAAAAACAACTGCAACTA
AAAGCCCATTTGCGCTATGCCCTTGAGCACACAGATTGGAAACAAGAGCGTGAAAAAGGATTTGTTTCAG
CCACTAAAGCCTTTATGCCTTTTGCTGGACCTATAAAAAATGCACAAGCAGAGTTAAGTGTATTGTCACT
TTATCAGCGTGTATATCAAGCCTTACGCTTAAAGGCTAATCAAGAGCTTTCAGCGCCTTTAAATTTACAA
CATCAAATTGGCCCAAGTTTTAATACGGTCTTTACGGCTATTGATGATGATAAATTAGAAATTCCACAAT
TCTTAACGCGCTCAGGGTTATTAAACTATTTTATCCGCCAAAATGATAAATTGGTCGAGCTAACATTACT
TGATGCTTGGGTTCTTAATCTAACCACCAACACACAATATAGTGAAAGTGATCGTAAAGAAATTCAGCGT
CAAATCAGTGAACAATATCTTAGTGACTATACGGCTCAATGGCGTAATGCCATGAGCAATTTAGAAATTC
GTCAATTTGATTCAATACAAGATGAAATTACCGCTCTTGAGCAAATTATTAGTGGTGAACAACCATTACG
CCGAGCATTACAAGTTCTACGTGATAACACGGTTATTCCAACTATTGATGAAAATTTACCACTTGATGAA
CAAAAAACACTGATGGCTGAGCCATCTTACCGTTTATTAACCCGCTTAGATCGCGAATTTACTCCTCAAA
CTGAGATATTAGTCAGTAACCAAGGGGAAAATTTACAGAATCTGAATCAAAAACTAAATGACTTACATCG
TTACCTATTGGGGATCCAAAACTCTCCAGTGCCGGGGAAAGCGGCGCTTAAAGCAGTTTCGATGCGCTTA
AACGATAATAATCGCGACGCTATTTTTGAGCTATCACAAATGGCGAAAACATTACCAGAGCCGCTTAACC
GCTGGGTCGATGAGTTATCAGTGCAAGCATGGAATGTGGTCCAAAAAGAAGCTATTCGTTATATGGAAGT
AGAATGGAATGAAAATGTTGTCAAACAATACAATACTTATATTGCCGGTCGCTATCCATTTAACCCAGCA
GCTAAACAAGATGTTCCTTTAAGTGAATTTGAACGTTTCTTCAAACCAAATGGAACATTAGATAGCTTCT
ATCAACAAAATCTGCGTTTATTCGTTGAGAATAACTTAGTTAACGATAGTGATAGCCAATCATTGATCCG
CGCTGATGTATTAGCACAAATTGAAATAGCCAATCGTATTAGAGAAACCTTCTTTAATGCCCAAGGTAAT
TTAGAAGCACAATATGCTATTGAGCCACTGTCATTAAGTGGTAATAAGCGTCGTAGCATCTTAAATCTTG
ATGGACAATTGATTGATTACGCTCATAGTCGCAGCCATGTGACACACTTGGTATGGCCAAACTCAATGCG
TTCCAATATTGAAAGTAAACTGACTTTAGTGCCTCTTTCCGGTGATAAATCGCCACGTTCAATCAGTTTC
TCTGGGCCATGGGCACAAATGCGATTAGTTGATAATGCAAAACTCATCAATATCAAATCTAACTCATTCG
ATATTCGCTTCACAATCGACGGTGGTGATATGACTTATCGAGTTATAGTTGATGAATCTAATAATCCTTT
CTTCGGTGGATTATTCACAAAATTCCGTTTACCTGAAACGCTTTATTAA
 Primer design