SecReT6
Protein ID: 197334334
SecReT6 ID299
T6SS typei1
Gene symbolclpV_1
Locus tagVFMJ11_1082
StrainVibrio fischeri MJ11
Repliconchromosome I [GenBank: NC_011184] [Browse all T6SS(s) in this replicon]
Location [Strand]1136375..1138957 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDB5FD85
KEGG IDvfm:VFMJ11_1082
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.80E-43, Aligned region: 208..231
AAA_2 [PF07724], Evalue: 2.80E-43, Aligned region: 593..758
AAA [PF00004], Evalue: 1.50E-20, Aligned region: 211..323
AAA [PF00004], Evalue: 1.50E-20, Aligned region: 598..724
ClpB_D2-small [PF10431], Evalue: 4.60E-13, Aligned region: 421..458
ClpB_D2-small [PF10431], Evalue: 4.60E-13, Aligned region: 764..833
AAA_16 [PF13191], Evalue: 6.40E-13, Aligned region: 188..228
AAA_16 [PF13191], Evalue: 6.40E-13, Aligned region: 254..289
AAA_16 [PF13191], Evalue: 6.40E-13, Aligned region: 454..454
AAA_16 [PF13191], Evalue: 6.40E-13, Aligned region: 576..633
AAA_16 [PF13191], Evalue: 6.40E-13, Aligned region: 662..691
AAA_5 [PF07728], Evalue: 2.20E-12, Aligned region: 211..235
AAA_5 [PF07728], Evalue: 2.20E-12, Aligned region: 467..476
AAA_5 [PF07728], Evalue: 2.20E-12, Aligned region: 597..718
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 44..73
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 211..297
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 340..371
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 595..616
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 659..716
NACHT [PF05729], Evalue: 1.00E-07, Aligned region: 211..238
NACHT [PF05729], Evalue: 1.00E-07, Aligned region: 598..633
Sigma54_activat [PF00158], Evalue: 1.30E-07, Aligned region: 198..246
Sigma54_activat [PF00158], Evalue: 1.30E-07, Aligned region: 595..719
AAA_25 [PF13481], Evalue: 1.00E-06, Aligned region: 211..250
AAA_25 [PF13481], Evalue: 1.00E-06, Aligned region: 270..306
AAA_25 [PF13481], Evalue: 1.00E-06, Aligned region: 593..629
AAA_25 [PF13481], Evalue: 1.00E-06, Aligned region: 703..753
AAA_23 [PF13476], Evalue: 5.40E-06, Aligned region: 211..227
AAA_23 [PF13476], Evalue: 5.40E-06, Aligned region: 441..480
AAA_23 [PF13476], Evalue: 5.40E-06, Aligned region: 595..727
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 205..233
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 597..615
IstB_IS21 [PF01695], Evalue: 1.40E-05, Aligned region: 706..727
AAA_29 [PF13555], Evalue: 1.80E-05, Aligned region: 205..227
AAA_29 [PF13555], Evalue: 1.80E-05, Aligned region: 593..622
DUF258 [PF03193], Evalue: 2.10E-05, Aligned region: 51..86
DUF258 [PF03193], Evalue: 2.10E-05, Aligned region: 180..230
DUF258 [PF03193], Evalue: 2.10E-05, Aligned region: 563..615
AAA_17 [PF13207], Evalue: 0.00012, Aligned region: 212..252
AAA_17 [PF13207], Evalue: 0.00012, Aligned region: 418..418
AAA_17 [PF13207], Evalue: 0.00012, Aligned region: 597..632
Arch_ATPase [PF01637], Evalue: 0.00017, Aligned region: 191..225
Arch_ATPase [PF01637], Evalue: 0.00017, Aligned region: 262..297
Arch_ATPase [PF01637], Evalue: 0.00017, Aligned region: 596..618
Mg_chelatase [PF01078], Evalue: 0.00043, Aligned region: 207..249
Mg_chelatase [PF01078], Evalue: 0.00043, Aligned region: 565..619
RNA_helicase [PF00910], Evalue: 0.00064, Aligned region: 212..233
RNA_helicase [PF00910], Evalue: 0.00064, Aligned region: 598..618
RNA_helicase [PF00910], Evalue: 0.00064, Aligned region: 698..716
AAA_10 [PF12846], Evalue: 0.001, Aligned region: 209..225
AAA_10 [PF12846], Evalue: 0.001, Aligned region: 279..296
AAA_10 [PF12846], Evalue: 0.001, Aligned region: 393..433
AAA_10 [PF12846], Evalue: 0.001, Aligned region: 596..768
MobB [PF03205], Evalue: 0.0011, Aligned region: 211..232
MobB [PF03205], Evalue: 0.0011, Aligned region: 596..616
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 211..231
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 492..513
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 599..632
AAA_19 [PF13245], Evalue: 0.0044, Aligned region: 208..228
AAA_19 [PF13245], Evalue: 0.0044, Aligned region: 595..622
Protein Sequence: 860 a.a.     [Download]
>gi|197334334|ref|YP_002155803.1| type VI secretion ATPase, ClpV1 family [Vibrio fischeri MJ11]
MINVELPQLIKTLDKESHLALEQAAQLCVTRGGNEVLCEDFILAALNNPQSFWNKACQQYNVSTDVLIEA
LQHGRKSTSSESNHPVLSTALIEWLQESYLFSMLEMQLSEVLAANLLLTLLSHPNKYGHTPYYRELSVIP
VASLKQQVEGLVSCANRDSQSSAEHQNALDAYTTNYTQLAKDNKIDPVLCRDSEIRQMIDILARRRKNNP
MIVGEAGVGKTALVEGLAIKIAQGEVPDILENVALLSLDLGLLQAGASIKGEFERRLNLVITAVQESPTP
IILFIDEAHTLIGAGGQAGSNDAANLLKPALARGELRTIGATTWSEYKKYIEKDPALARRFQPVKVDEPN
VTQAVTILRGLAERYEESHGVYVRDDAIIAAAELSARYISGRQLPDKAIDLLDTACARVKINLKAKPESL
ETLLHIIAITQRELDCVLRDQQAGINIEENTITQLKEKLSQTHLDAEQLEQEWQTQKELAEALLTSRIDI
AQCNDEEEKHRLICNQQEIHQALSDAQHTHSLVNYETCPSLVAEVVSHWTGIPMSTLQRGQATQVLTIKS
KLKEQIKGQDQAVIALEKAIQATAAGLNNPNSPTGVFLFVGPSGVGKTQTAQAIADLMYGGEQFLTTINM
SEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAVRQRPYSVVLLDEVEKADREIMNLFYQIFDKGVANDGEG
REINFKQTLIIMTSNLASDQIEALCNQEEKPTTDALTKAIRPTLNQYFKPALVGRMTVVPFFPLDMESME
ALVDIRLKQLTEQLSLQQITLHYDEAIIQHIAQSCTLTETGARNIDAIINGQLKPAFSSQILLALARKEP
LTSISLCIDENGQVFCEFED
 
Nucleotide Sequence: 2583 bp     [Download]
>gi|197333880|ref|NC_011184.1|:c1138957-1136375 Vibrio fischeri MJ11 chromosome I, complete sequence
ATGATTAACGTAGAACTACCTCAATTAATTAAAACATTAGATAAAGAGTCACATCTTGCGTTAGAGCAAG
CTGCACAATTATGCGTCACTCGTGGCGGTAATGAAGTGTTATGTGAAGACTTTATTCTTGCGGCACTGAA
TAATCCACAAAGTTTCTGGAATAAAGCTTGTCAGCAATACAATGTATCTACTGATGTTTTAATTGAAGCG
CTACAACACGGAAGAAAAAGCACCTCATCTGAAAGTAATCACCCCGTTTTATCAACTGCGTTAATTGAAT
GGCTTCAAGAAAGTTATCTTTTCTCCATGCTAGAAATGCAGCTTTCTGAAGTATTAGCAGCGAACTTACT
GCTGACTCTCCTTTCTCATCCAAACAAATATGGGCACACCCCCTATTACCGTGAACTCAGTGTTATTCCT
GTCGCTTCATTAAAACAACAGGTTGAAGGCTTAGTCAGCTGCGCGAATCGAGATTCTCAATCCTCTGCTG
AACATCAAAATGCACTCGATGCATACACGACCAATTACACACAATTGGCGAAAGATAATAAAATTGATCC
TGTTTTATGCCGAGATTCTGAAATTCGTCAAATGATCGATATTTTAGCCCGTCGCCGTAAAAATAACCCA
ATGATTGTTGGCGAAGCGGGGGTTGGCAAAACTGCATTAGTAGAAGGTTTAGCAATAAAAATAGCTCAAG
GAGAAGTGCCCGATATACTTGAAAATGTCGCCCTTCTCTCTTTGGATCTTGGGTTACTTCAAGCAGGTGC
AAGTATTAAAGGTGAATTTGAACGTCGCTTAAATTTGGTTATCACAGCAGTTCAAGAAAGTCCGACACCT
ATTATCTTATTTATTGATGAAGCACATACTCTAATTGGTGCTGGTGGACAAGCTGGTAGCAATGATGCAG
CAAACCTTCTCAAACCAGCTCTTGCTCGAGGTGAATTACGTACAATAGGTGCAACAACGTGGTCTGAATA
TAAAAAATACATAGAAAAAGATCCAGCACTTGCACGACGTTTCCAACCGGTAAAAGTAGACGAACCAAAT
GTTACTCAAGCTGTAACAATTTTACGAGGTCTTGCTGAACGTTATGAGGAAAGCCACGGTGTTTATGTAA
GAGATGATGCCATCATTGCCGCCGCTGAATTATCTGCACGTTACATTAGCGGTCGTCAACTACCAGATAA
AGCCATCGATCTTCTTGATACAGCTTGTGCACGTGTGAAGATCAATTTAAAAGCAAAGCCTGAGTCATTA
GAAACGTTATTGCATATTATTGCTATTACTCAACGTGAGCTTGATTGTGTATTAAGAGATCAACAAGCAG
GAATTAATATTGAAGAAAACACCATCACTCAATTGAAAGAAAAGCTGTCTCAAACCCACCTTGACGCTGA
ACAGTTAGAGCAAGAATGGCAAACACAAAAAGAATTAGCCGAAGCGCTACTAACTTCTCGAATTGACATT
GCACAATGTAACGATGAAGAAGAAAAGCATCGATTAATTTGCAACCAGCAAGAGATACATCAAGCGCTAT
CGGATGCACAGCACACACACTCTTTAGTCAATTACGAAACCTGCCCATCTTTGGTTGCTGAAGTAGTATC
CCATTGGACAGGCATTCCAATGAGTACACTACAACGTGGACAAGCGACTCAAGTACTTACGATAAAATCA
AAGCTAAAAGAGCAAATCAAAGGTCAGGATCAAGCCGTCATCGCCTTAGAAAAAGCAATCCAAGCCACTG
CAGCAGGATTAAATAACCCTAATTCTCCAACCGGTGTATTTCTTTTTGTTGGTCCAAGTGGTGTAGGCAA
AACTCAAACTGCTCAAGCCATTGCCGATTTAATGTATGGCGGCGAACAATTTCTCACCACCATCAATATG
TCAGAGTTTCAAGAAAAACACACCGTATCTCGTCTAATTGGTTCGCCTCCTGGCTACGTTGGATATGGTG
AAGGCGGTGTGTTAACTGAAGCCGTTCGTCAACGCCCTTATTCCGTTGTATTACTGGATGAAGTAGAAAA
AGCAGACCGTGAAATCATGAACCTTTTCTATCAAATTTTTGATAAAGGTGTCGCTAATGATGGTGAAGGA
AGAGAAATCAACTTCAAACAAACGCTAATAATCATGACGTCAAACTTAGCCTCTGATCAAATTGAAGCAC
TTTGTAACCAAGAAGAAAAGCCGACCACAGATGCATTAACTAAAGCCATCCGTCCAACGTTAAATCAGTA
TTTTAAACCCGCCTTAGTCGGACGAATGACCGTTGTCCCATTCTTCCCTCTTGATATGGAAAGTATGGAA
GCCCTTGTAGATATTCGCCTTAAACAATTAACCGAACAGCTGTCATTGCAACAAATCACTCTTCATTATG
ACGAAGCAATCATTCAACACATTGCTCAAAGTTGTACATTAACTGAAACCGGTGCGAGAAATATTGATGC
CATTATTAATGGACAACTAAAACCTGCATTTTCATCCCAAATACTGCTAGCACTGGCTAGAAAAGAACCA
TTGACCAGTATATCTCTATGTATCGATGAAAATGGCCAAGTCTTTTGCGAGTTTGAGGACTAG
 Primer design