SecReT6
Protein ID: 197334721
SecReT6 ID299
T6SS typei1
Gene symbolvasA_1
Locus tagVFMJ11_1084
StrainVibrio fischeri MJ11
Repliconchromosome I [GenBank: NC_011184] [Browse all T6SS(s) in this replicon]
Location [Strand]1139958..1141709 [-]
Producttype VI secretion protein, family
NoteTssF
UniProt IDB5FD87
KEGG IDvfm:VFMJ11_1084
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-169, Aligned region: 3..583
Protein Sequence: 583 a.a.     [Download]
>gi|197334721|ref|YP_002155805.1| type VI secretion protein, family [Vibrio fischeri MJ11]
MSFNHYYQSELAALRELGKSFSRENPALAPYLGQEGLDPDIERLFEGFAFLVGRLHQRLDNQLPELTHSL
MRLLWPNYVQAIPAMSTLQFTPASEATQASTIKRGTEVLSQPIDGVQCKFKTCFDVDIYPVSLHSSSFTA
NGHGGIYQLRLELPSGIDLASLNMKQLRVHFNGDKASCLSLIMALCSSTTQAEFCALDKELEQINRSTFP
IHSIKPVGFKTNEAIFDYPLNTFEGYRHIQEFFCYPEKYYYIDLTELPVWPAQFSQGCKYVDLKFTLDNI
TQQPFYANRVQPELFCTPIVNSFKSDTQPLLLNHRKDHYKITPVSLNDDSSTILSVKEVHGWNPGQKGRI
DFYHFESFEHNENKNRSNYYSIRQEKNIVSGHFDTYLSFRSQHTFTNSVTVSIAVTACNGALAQRLSVNS
ITETTDQTTGSATFTNIRTVTPCYTPPIDKDGLWSLISNMSLNYLSLTKPEAFKRILLAYDFAGQQDDAK
GKKHKRLIDGIVNISTKPCDMLYEGAPVRAMNTQLHLNTKHFLCEGELYLFSTVINEFLSLYTSMNSFNQ
LHVTSTDGGDYSWLPRMGQQPLI
 
Nucleotide Sequence: 1752 bp     [Download]
>gi|197333880|ref|NC_011184.1|:c1141709-1139958 Vibrio fischeri MJ11 chromosome I, complete sequence
ATGAGTTTTAATCATTACTATCAATCTGAATTAGCAGCACTGCGCGAATTGGGAAAGTCGTTTTCGAGAG
AAAATCCGGCTTTAGCCCCCTATTTAGGTCAAGAGGGATTGGATCCGGATATTGAGCGATTATTCGAAGG
GTTCGCTTTTTTAGTTGGTCGTTTACATCAACGCTTAGATAACCAGTTACCAGAATTAACTCATTCATTA
ATGCGTTTATTGTGGCCTAACTATGTCCAAGCAATTCCAGCAATGAGTACTCTGCAATTTACACCAGCAA
GTGAAGCAACCCAAGCATCAACAATTAAACGTGGTACGGAAGTGCTTAGCCAACCTATTGATGGCGTTCA
ATGTAAGTTTAAAACGTGTTTTGATGTTGATATTTATCCTGTATCTCTTCATTCATCGTCTTTTACAGCA
AATGGGCATGGTGGCATTTATCAATTACGATTGGAATTACCTTCAGGAATCGATCTAGCATCGTTAAATA
TGAAACAATTACGTGTTCATTTTAATGGTGACAAAGCCAGTTGCTTGTCTCTCATTATGGCGCTTTGCTC
TTCCACCACTCAAGCTGAGTTTTGCGCTTTGGATAAAGAGTTAGAACAAATCAATCGCTCAACGTTTCCA
ATCCATAGCATTAAACCTGTTGGCTTTAAAACCAATGAAGCTATTTTTGATTACCCTCTCAATACGTTTG
AAGGCTACCGACACATTCAAGAATTTTTTTGTTACCCAGAAAAATATTACTACATTGACTTAACTGAGTT
ACCAGTTTGGCCAGCTCAGTTTAGTCAAGGGTGTAAATATGTCGATTTAAAATTCACGTTAGATAACATC
ACACAACAGCCTTTTTACGCTAATCGTGTTCAACCAGAGCTATTTTGTACCCCAATCGTTAATTCATTTA
AAAGTGATACTCAACCACTCTTACTTAACCACAGAAAAGATCATTATAAGATCACACCGGTTTCTTTAAA
TGACGATAGCAGTACCATTTTATCTGTCAAAGAAGTACACGGTTGGAACCCAGGACAAAAAGGTCGTATC
GATTTTTACCACTTTGAATCATTTGAACATAATGAAAATAAAAATCGCTCAAACTATTACAGTATCCGCC
AAGAAAAAAACATTGTCAGTGGGCACTTTGATACGTATCTATCGTTTCGTTCTCAACACACCTTTACCAA
TAGCGTGACGGTTTCTATTGCCGTTACTGCATGTAATGGGGCATTAGCTCAGCGTTTATCTGTAAACTCT
ATTACAGAAACAACAGATCAAACAACTGGTTCAGCAACATTTACCAATATCAGAACAGTAACGCCTTGCT
ACACCCCACCCATTGATAAAGATGGTCTTTGGTCACTCATATCAAATATGTCCCTTAATTATCTTTCATT
AACCAAGCCAGAAGCGTTTAAACGCATTTTGCTGGCTTATGATTTTGCTGGCCAACAAGATGATGCAAAA
GGAAAAAAACATAAAAGACTGATCGATGGCATCGTAAATATATCGACCAAACCTTGCGATATGTTATATG
AAGGTGCTCCTGTACGAGCAATGAATACTCAACTTCACCTCAACACGAAACACTTTTTATGTGAAGGCGA
ACTGTATTTATTTTCCACTGTAATTAATGAATTTTTATCGCTTTATACCAGTATGAATTCATTTAACCAA
TTGCACGTTACAAGTACTGATGGAGGAGACTATTCATGGCTACCACGAATGGGGCAACAACCTCTAATTT
AG
 Primer design