SecReT6
Protein ID: 197334802
SecReT6 ID299
T6SS typei1
Gene symbol-
Locus tagVFMJ11_1077
StrainVibrio fischeri MJ11
Repliconchromosome I [GenBank: NC_011184] [Browse all T6SS(s) in this replicon]
Location [Strand]1131494..1132816 [-]
Producttype VI secretion protein, family
NoteTssK
UniProt IDB5FD80
KEGG IDvfm:VFMJ11_1077
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.90E-129, Aligned region: 16..438
Protein Sequence: 440 a.a.     [Download]
>gi|197334802|ref|YP_002155798.1| type VI secretion protein, family [Vibrio fischeri MJ11]
MQKVIWKEGMLLRPQHFQQSDRYYQNQLQVRTQKQHRFNWGFHSLSFDNHHLSVGKIVISQASGILPDGS
LFDIQHQTTPIVWESDAPKTNLNLYLAISLSTINSPEARDEKETEINTRYVSHDLTISDNNAQVQNLQTI
SCGELDFHIITEEEIDNHWVKIKLCEIKQVTPEGAIQLNPNFEASFINGVHSSLVHRSLREVLTLVTHKA
DILAERITKSGHATSEIGDFLLLQLLNKYEPQLHYLNKCSQYHPEELFLLLSSLQGELSTYDSGHRRPDL
KLSYNHKEQGESFDQILFHLRKQLNQSLKQNAFEIPLQKRNHGVLIAPISDDSLLQEATFILAARSHTDA
ESLRKQLPPQLKVGPVEKIRNLVNLQLPGITCRSLSVAPRQVPFHGDYCYFTLDLTSNDRSQLTQSGGFA
FHIAGDFPELSLFFWAIRNS
 
Nucleotide Sequence: 1323 bp     [Download]
>gi|197333880|ref|NC_011184.1|:c1132816-1131494 Vibrio fischeri MJ11 chromosome I, complete sequence
ATGCAAAAAGTTATATGGAAAGAAGGCATGCTATTGCGGCCTCAACATTTCCAACAAAGTGATCGTTACT
ATCAAAATCAACTGCAAGTACGTACGCAGAAGCAACACAGGTTTAATTGGGGTTTCCATTCTCTGAGTTT
TGATAATCATCATTTATCTGTTGGAAAGATCGTGATCAGTCAGGCTAGTGGTATTTTACCCGATGGTTCA
CTATTTGATATTCAACATCAAACAACCCCTATTGTTTGGGAGTCTGATGCGCCTAAAACAAACTTAAATC
TGTATTTAGCGATTTCTTTATCGACTATCAATAGTCCAGAAGCTCGCGATGAAAAAGAAACCGAAATTAA
CACTCGTTATGTTTCTCACGATTTAACCATTTCAGATAATAATGCCCAAGTACAAAACTTGCAGACTATC
AGTTGTGGTGAGTTGGATTTTCATATTATTACCGAAGAAGAGATTGATAATCATTGGGTTAAAATTAAAC
TGTGTGAAATTAAACAAGTCACTCCAGAAGGTGCGATTCAACTCAACCCTAATTTTGAAGCGAGTTTTAT
TAATGGTGTTCACTCGTCTCTTGTTCACCGTTCGCTACGAGAAGTCTTAACACTCGTTACTCATAAAGCC
GATATTTTAGCCGAACGTATTACGAAATCAGGGCACGCAACCTCTGAAATTGGTGACTTCTTATTACTTC
AATTATTAAATAAGTATGAGCCTCAACTCCACTATCTAAATAAGTGCTCTCAATACCATCCAGAGGAGCT
CTTTTTATTACTTTCATCTTTGCAAGGAGAGCTGTCTACTTATGATTCTGGTCATCGTCGACCAGATCTA
AAATTATCATACAATCATAAAGAACAAGGCGAGTCATTTGATCAGATCTTATTTCATTTGCGTAAACAAC
TGAATCAGTCATTAAAACAAAACGCCTTTGAGATACCACTACAAAAACGCAATCACGGTGTACTTATTGC
CCCTATTTCTGATGATAGCTTATTGCAAGAAGCCACCTTTATTCTCGCGGCTCGCTCTCACACCGATGCT
GAAAGCTTACGAAAACAACTGCCACCACAATTAAAAGTCGGGCCTGTTGAAAAAATTCGCAACCTTGTAA
ACCTTCAATTACCGGGTATCACTTGTCGCTCACTTTCCGTAGCCCCAAGACAAGTTCCTTTCCATGGTGA
TTATTGTTATTTCACCCTTGATTTAACCTCAAACGATCGCTCCCAACTAACGCAATCTGGAGGATTTGCC
TTCCATATTGCAGGTGATTTCCCTGAGCTTTCTCTTTTCTTTTGGGCAATAAGGAATAGTTAA
 Primer design