SecReT6
Protein ID: 197334873
SecReT6 ID299
T6SS typei1
Gene symbol-
Locus tagVFMJ11_1087
StrainVibrio fischeri MJ11
Repliconchromosome I [GenBank: NC_011184] [Browse all T6SS(s) in this replicon]
Location [Strand]1143700..1144200 [-]
Producttype VI secretion protein, family
NoteTssB
UniProt IDB5FD90
KEGG IDvfm:VFMJ11_1087
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.10E-54, Aligned region: 5..160
Protein Sequence: 166 a.a.     [Download]
>gi|197334873|ref|YP_002155808.1| type VI secretion protein, family [Vibrio fischeri MJ11]
MSKDGSVAPKERVNVTFKPVSGDAAEDLELPLKMMVLGDFTQQEDDRKLEDRKPFNVDKSNFNDVIEKQN
LNISFGVKNQLQDDGEGNEEIAVDLSFKHINDFDPSSIVEQVPELKGLMDLREALVSLKGPLGNVPAFRK
AIEDALVDDEAREKLLSELGLVTEKE
 
Nucleotide Sequence: 501 bp     [Download]
>gi|197333880|ref|NC_011184.1|:c1144200-1143700 Vibrio fischeri MJ11 chromosome I, complete sequence
ATGTCAAAAGATGGATCTGTTGCACCAAAAGAACGTGTAAATGTGACATTCAAACCAGTAAGCGGTGACG
CTGCAGAAGATCTTGAACTTCCACTGAAAATGATGGTTCTTGGTGACTTTACTCAGCAAGAAGATGATAG
AAAACTTGAAGATCGAAAACCATTTAATGTTGATAAAAGCAATTTCAATGACGTTATTGAAAAACAAAAC
CTAAACATTTCTTTTGGTGTGAAAAACCAACTTCAAGATGATGGCGAAGGAAATGAGGAAATAGCAGTTG
ATCTAAGTTTTAAACATATCAATGATTTTGATCCTTCAAGCATTGTTGAGCAAGTACCTGAACTAAAAGG
CTTAATGGATTTACGTGAAGCGCTTGTCTCTTTAAAAGGCCCGTTAGGCAATGTTCCTGCATTCCGCAAA
GCAATTGAAGATGCCCTTGTTGATGATGAAGCTCGTGAAAAACTACTAAGTGAATTAGGTCTAGTGACAG
AAAAGGAATAA
 Primer design