SecReT6
Protein ID: 197335286
SecReT6 ID299
T6SS typei1
Gene symbol-
Locus tagVFMJ11_1076
StrainVibrio fischeri MJ11
Repliconchromosome I [GenBank: NC_011184] [Browse all T6SS(s) in this replicon]
Location [Strand]1130659..1131492 [-]
Producthypothetical protein
NoteTssL
UniProt IDB5FD79
KEGG IDvfm:VFMJ11_1076
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.60E-65, Aligned region: 57..261
Protein Sequence: 277 a.a.     [Download]
>gi|197335286|ref|YP_002155797.1| hypothetical protein VFMJ11_1076 [Vibrio fischeri MJ11]
MNSSSMDDRTVLITQEPNQVNPTLTESPSAPKFNQLQERMVYAARIKPEEYNFAGNNPLISAASSLLCIT
CDLKKESYQDIELLKPKLVEELKSFEFQAINSGVESNYVALSRYLLCTFVDEIIVTTPWGSESHWASKSM
LSSFHNETYGGEKFFLLLEKLSRNPAKYLDLLELMYLCLSLGFEGKYRVLSRGLVELDAIRDSLYRQIRS
LRGDEQASLSPNWEPKQVQRHKLTRQTSWVGIVCVVVFSLCAIYGGFYYVLDQQSEHVIQAFQQIDL
 
Nucleotide Sequence: 834 bp     [Download]
>gi|197333880|ref|NC_011184.1|:c1131492-1130659 Vibrio fischeri MJ11 chromosome I, complete sequence
ATGAACAGCAGTAGCATGGATGACCGTACTGTACTTATCACACAAGAGCCAAATCAAGTTAACCCAACAT
TAACTGAAAGCCCAAGTGCACCCAAATTCAACCAGCTTCAAGAACGAATGGTTTACGCCGCGCGTATTAA
ACCAGAAGAATACAATTTTGCAGGAAACAACCCACTAATCAGTGCTGCTTCCTCATTACTCTGTATCACG
TGTGACTTAAAAAAAGAAAGCTACCAAGATATTGAGTTACTAAAACCTAAATTAGTTGAAGAGTTAAAAT
CCTTCGAGTTTCAAGCGATTAACTCAGGTGTTGAGAGTAATTATGTTGCCTTATCTCGCTACCTGCTTTG
CACTTTCGTTGATGAAATTATCGTAACAACGCCATGGGGTTCAGAAAGTCACTGGGCCTCAAAAAGTATG
TTAAGTAGCTTTCATAACGAAACATATGGTGGTGAGAAATTTTTCTTACTATTAGAAAAGCTCAGTAGGA
ACCCTGCTAAATATTTAGATTTATTAGAGTTAATGTACTTATGTTTGAGCTTAGGTTTTGAAGGCAAATA
TCGAGTGTTATCAAGAGGTCTGGTCGAATTAGACGCCATTCGTGATTCTCTTTATCGCCAAATTCGCTCT
TTACGAGGAGATGAGCAAGCTAGCCTCTCTCCAAACTGGGAGCCGAAACAAGTTCAACGCCATAAACTCA
CAAGACAAACCTCTTGGGTTGGCATCGTATGCGTTGTGGTTTTCTCATTGTGTGCTATTTACGGTGGTTT
CTATTATGTATTGGACCAACAATCAGAGCATGTAATTCAAGCTTTTCAGCAAATTGATTTATAG
 Primer design