SecReT6
Protein ID: 197335473
SecReT6 ID299
T6SS typei1
Gene symbol-
Locus tagVFMJ11_1086
StrainVibrio fischeri MJ11
Repliconchromosome I [GenBank: NC_011184] [Browse all T6SS(s) in this replicon]
Location [Strand]1142221..1143696 [-]
Producttype VI secretion protein, EvpB/family
NoteTssC
UniProt IDB5FD89
KEGG IDvfm:VFMJ11_1086
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.00E-193, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|197335473|ref|YP_002155807.1| type VI secretion protein, EvpB/family [Vibrio fischeri MJ11]
MSDTSTAQELDNQVTVGLLDQIVAQTNLTPEDETYGIAKRGVSAFIEELLKPQNQEEPVKKALIDKMITE
IDQRLSKQVDEILHHSSFQQLESAWRGLKLLVDRTDFRENIKIEVINVSKTDLLEDFEDASEITQSGLYK
HVYTNEFGTFGGQPVGAIIGNYDFGPSAPDIKNLQNLASVAAMSHAPFISAAGPKFFGLESFEGLPDLKD
LNDHFESPQYAKWQSFREQEDSRYVGLTLPRFLLRQPYDPEENPVKAFNYHENVSATHEDYLWGNTAFTM
ATRITESFANFRWCPNIIGPQSGGAVEDLPLHHFESMGDIETKIPTEVLVSDRREYELAEEGFIALTMRK
GSDNAAFFSANSVQKAKFFGNTEEGKNAELNFRLGTQLPYLFIISRLAHYIKVLQREQIGSWKERTDLEQ
ELNTWIRQYIADQENPPAEVRSRRPLRAANIEVMDVEGNPGWYKVNLSVRPHFKYMGSDFTLSLVGKLDQ
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|197333880|ref|NC_011184.1|:c1143696-1142221 Vibrio fischeri MJ11 chromosome I, complete sequence
ATGTCAGATACAAGCACAGCACAAGAGCTAGATAACCAAGTTACTGTTGGACTTCTTGATCAAATCGTAG
CTCAAACCAATTTAACTCCAGAAGATGAAACATACGGTATTGCTAAGCGTGGTGTCAGCGCTTTTATTGA
AGAGTTATTAAAACCTCAAAATCAAGAAGAACCAGTCAAAAAAGCACTGATTGATAAAATGATCACAGAG
ATTGATCAACGCTTAAGTAAACAAGTTGACGAAATTCTTCACCACTCTTCTTTTCAACAACTTGAATCTG
CTTGGCGTGGATTAAAATTACTCGTTGATCGCACCGATTTTCGTGAAAATATTAAAATCGAAGTGATTAA
TGTATCTAAAACAGACTTGTTAGAGGACTTCGAAGATGCTTCAGAAATTACTCAATCAGGACTCTACAAG
CATGTCTACACTAACGAGTTTGGTACATTTGGTGGCCAACCTGTTGGTGCTATTATTGGTAATTATGACT
TTGGTCCTTCTGCGCCTGATATTAAAAACCTTCAAAACCTGGCTTCTGTAGCAGCGATGTCTCATGCACC
ATTTATTTCAGCCGCAGGTCCTAAATTCTTTGGCTTAGAATCATTTGAGGGATTACCTGATCTAAAAGAT
CTTAATGATCATTTTGAAAGCCCCCAATATGCAAAATGGCAAAGCTTCCGTGAGCAAGAAGACTCAAGAT
ATGTAGGCTTAACATTACCTAGATTCTTATTACGTCAACCTTATGACCCAGAAGAAAACCCTGTAAAAGC
GTTCAATTACCATGAAAATGTTTCTGCTACTCACGAAGATTATTTATGGGGAAATACCGCTTTTACAATG
GCAACTCGTATCACTGAAAGTTTTGCTAATTTCCGTTGGTGTCCAAATATTATTGGTCCTCAATCAGGTG
GTGCAGTGGAAGATCTACCACTCCACCACTTTGAAAGTATGGGAGATATTGAAACTAAAATCCCAACAGA
AGTTCTTGTTTCCGACCGAAGAGAGTATGAATTAGCAGAGGAAGGCTTTATTGCTCTCACTATGCGTAAG
GGCTCAGATAATGCGGCTTTCTTCTCTGCCAACTCCGTTCAAAAAGCGAAGTTTTTTGGCAATACCGAAG
AAGGTAAAAACGCTGAGTTAAATTTCCGTTTGGGTACGCAACTCCCTTACTTGTTCATTATTAGCCGTCT
TGCACATTACATTAAAGTGCTACAGCGTGAACAAATCGGTAGCTGGAAAGAACGTACAGACTTAGAACAA
GAGTTAAACACTTGGATTCGTCAATACATTGCTGATCAAGAAAATCCACCAGCAGAAGTTCGTAGCCGTC
GTCCACTTCGTGCAGCCAATATCGAAGTAATGGACGTTGAAGGCAATCCAGGTTGGTACAAAGTAAACCT
ATCAGTTCGCCCACACTTCAAATACATGGGTTCTGATTTTACTTTGTCGTTAGTTGGTAAATTGGATCAA
GAGTAA
 Primer design