SecReT6
Protein ID: 197335638
SecReT6 ID299
T6SS typei1
Gene symbol-
Locus tagVFMJ11_1079
StrainVibrio fischeri MJ11
Repliconchromosome I [GenBank: NC_011184] [Browse all T6SS(s) in this replicon]
Location [Strand]1133356..1134666 [-]
Producttype VI secretion system FHA domain-containing protein
NoteFha
UniProt IDB5FD82
KEGG IDvfm:VFMJ11_1079
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.10E-15, Aligned region: 29..97
FHA [PF00498], Evalue: 2.10E-15, Aligned region: 266..293
FHA [PF00498], Evalue: 2.10E-15, Aligned region: 398..409
Protein Sequence: 436 a.a.     [Download]
>gi|197335638|ref|YP_002155800.1| type VI secretion system FHA domain-containing protein [Vibrio fischeri MJ11]
MELAFDIIQSQDLPIDTLPTFTFKKAGGTIGRSPNADWYIADSKRQLSNVHASISFEDDQFFITDNSTNG
TYFNGEEASLNSGELHPVSHGDVYELGFIKIRARLLQDPTNYRSPETNPNASRDPLSNHGTDESPSVFDM
IPDDSFLSDGPIEELLNSDEEIILKQVEESTPSHTQMDDVLLKEQFISPIFNEEELSNDSLDDEIELEPT
YQPKRSKEKINTTSKKKIDSITNKEVPDVQVTSNEPYLAALSKGLGIELTNLEDPEQTLFDIGSALRSSV
NGIQQLLRTRTEIKNKLTANATTIQGQGNNPIKFTHDVNDALNIIIHHKPGYLQGIEAINQSCKDIQANQ
LAIHDACQHTLDALIEKLSPETLIYRFVQDGIQSKFGKPDAKYWQAYSKLHKQISKDPDWRNALLEQDFA
KQYESQLQMLTAALRV
 
Nucleotide Sequence: 1311 bp     [Download]
>gi|197333880|ref|NC_011184.1|:c1134666-1133356 Vibrio fischeri MJ11 chromosome I, complete sequence
ATGGAACTGGCTTTTGATATTATTCAATCACAAGATTTACCTATTGATACCTTACCTACTTTTACCTTCA
AAAAGGCTGGTGGAACCATTGGTCGCAGTCCAAATGCCGATTGGTATATTGCAGATAGTAAAAGACAATT
ATCAAACGTTCATGCTTCAATTAGCTTTGAGGATGATCAATTTTTTATTACCGATAACAGTACCAATGGC
ACCTACTTCAATGGTGAAGAAGCATCACTGAATAGCGGTGAATTACATCCTGTATCTCATGGGGATGTTT
ATGAGCTTGGCTTCATTAAAATTCGTGCTCGTCTATTACAAGATCCAACCAATTATCGCTCACCAGAAAC
AAATCCAAATGCTTCTCGTGATCCTTTATCAAACCATGGTACGGATGAATCACCATCGGTATTTGACATG
ATCCCTGATGACAGCTTTTTAAGTGATGGACCAATTGAAGAACTATTAAATTCAGACGAAGAAATCATTC
TAAAACAAGTAGAAGAATCGACACCTTCTCATACACAAATGGATGATGTGCTACTTAAAGAGCAATTCAT
TTCTCCAATATTTAATGAAGAAGAACTTAGCAATGATTCCCTTGATGATGAGATTGAGCTAGAACCGACT
TATCAACCAAAAAGATCAAAGGAAAAGATCAATACAACCTCTAAAAAGAAAATAGATAGCATCACAAACA
AAGAAGTGCCTGATGTACAAGTAACCTCAAACGAGCCTTATTTAGCAGCATTATCTAAAGGATTAGGCAT
CGAACTTACTAATCTCGAAGATCCAGAACAAACCTTATTTGATATTGGATCAGCGCTTCGTAGTTCAGTA
AATGGCATCCAACAATTGCTACGTACGCGTACTGAAATCAAAAATAAATTAACAGCGAATGCCACCACGA
TTCAAGGCCAAGGTAATAACCCAATAAAATTCACCCATGATGTTAACGATGCACTCAATATCATTATTCA
TCATAAACCTGGGTATCTACAAGGGATTGAAGCCATCAACCAAAGCTGTAAAGACATCCAAGCGAATCAA
TTGGCTATTCATGATGCTTGCCAACATACGTTAGATGCATTGATTGAAAAACTCTCTCCAGAAACGCTGA
TATATCGCTTTGTGCAAGACGGAATACAAAGCAAGTTTGGTAAACCTGACGCCAAATATTGGCAGGCTTA
CAGCAAACTACATAAACAAATCAGTAAGGACCCTGATTGGCGCAACGCATTATTAGAGCAAGATTTTGCT
AAGCAATATGAATCTCAATTACAAATGCTCACAGCAGCACTTCGTGTGTAA
 Primer design