SecReT6
Protein ID: 197335960
SecReT6 ID299
T6SS typei1
Gene symbol-
Locus tagVFMJ11_1088
StrainVibrio fischeri MJ11
Repliconchromosome I [GenBank: NC_011184] [Browse all T6SS(s) in this replicon]
Location [Strand]1144216..1145766 [-]
Producttype VI secretion-associated protein, family
NoteTssA
UniProt IDB5FD91
KEGG IDvfm:VFMJ11_1088
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.10E-09, Aligned region: 47..107
ImpA-rel_N [PF06812], Evalue: 2.10E-09, Aligned region: 394..410
Protein Sequence: 516 a.a.     [Download]
>gi|197335960|ref|YP_002155809.1| type VI secretion-associated protein, family [Vibrio fischeri MJ11]
MFSYDSILSDISDKDRLGTDLTYEPEFELIEEEIKKSTNLFATSKTDWSTVHDNSLNLLNETSKDYRLLY
WLCLSITKRNLAIDNNELIRVINDFIIKFKDDIYPRRKRSLYSSINQIINIITDTTKSIIDNIDNINDAD
ILITQLSVLDDSIESIFENNTDNLSSVISLIKKLKKRLKSETENNEIVTAQSIPSAPTQAPSTTSTISFS
QDDITNDRDANKAFRHLQDVARTLSKYWLSQKLNDEKVFQLNRTLTWLTISQLPASNDDNVTMLKPVPQA
RTQYFQQLKAELNHSALVIEMEESLSKSPFWIDGHFMVWESLTALNHHDAAQSITDQLSLLINKTPSITD
LKFDDGTEFASESTKAWIQQHCSTSTHTTTAPVSHFDESQNSSDWEDALQEALTLLQQHSLNEVMQPLIR
GHHQSRSNREAFFWQFTQAKLLFQSSKYELANSLFSWLDKQYSQSVLAHWDPILEERLLELWLQCHNKLS
KKDQDSQLLTHIRERLCCLNPIRVLN
 
Nucleotide Sequence: 1551 bp     [Download]
>gi|197333880|ref|NC_011184.1|:c1145766-1144216 Vibrio fischeri MJ11 chromosome I, complete sequence
ATGTTTTCTTACGACTCAATCCTTTCTGATATATCAGATAAGGATCGCTTAGGCACAGATTTAACTTATG
AGCCTGAGTTTGAATTAATTGAAGAAGAAATAAAAAAATCAACGAATCTGTTTGCTACAAGCAAGACGGA
CTGGTCTACCGTGCATGATAACTCATTGAATTTACTAAATGAAACTAGTAAGGATTATAGATTACTTTAC
TGGTTGTGCTTATCTATAACTAAGAGAAATCTTGCTATTGATAATAATGAGTTAATCCGTGTTATTAATG
ATTTCATCATTAAATTCAAAGACGATATTTACCCAAGAAGAAAAAGAAGTTTATATTCCTCTATTAATCA
AATCATTAATATAATTACAGATACCACAAAATCTATTATCGATAATATAGACAATATAAATGATGCAGAT
ATATTAATTACACAATTATCAGTATTAGATGATTCAATTGAGTCTATTTTTGAAAATAATACAGATAATT
TATCTTCTGTTATTTCATTAATCAAAAAACTTAAAAAACGTTTAAAATCAGAAACCGAAAATAATGAGAT
AGTAACAGCACAATCTATACCATCGGCACCAACACAAGCTCCATCAACAACATCAACTATCTCATTTTCT
CAAGATGACATCACAAACGATAGAGATGCAAATAAAGCATTTCGTCACTTACAAGATGTAGCGAGAACAC
TCTCAAAATACTGGTTATCTCAAAAACTTAATGATGAAAAAGTTTTTCAATTAAACCGAACTCTAACATG
GCTAACCATATCGCAATTACCTGCAAGTAATGATGATAATGTAACTATGTTAAAGCCCGTTCCTCAAGCT
AGAACACAATATTTCCAACAATTAAAAGCTGAGTTAAATCACTCTGCATTGGTTATAGAAATGGAAGAGA
GCCTTTCTAAATCACCATTTTGGATTGATGGCCATTTCATGGTTTGGGAAAGCCTAACGGCACTTAATCA
TCATGATGCAGCACAAAGCATCACAGATCAGTTGTCTCTATTAATCAACAAAACACCAAGCATCACCGAT
CTTAAATTCGATGATGGAACTGAGTTTGCTAGTGAATCAACAAAAGCTTGGATACAGCAGCACTGTTCTA
CTTCAACTCATACTACTACAGCTCCAGTAAGTCATTTCGATGAATCACAAAATAGCAGTGACTGGGAAGA
TGCGCTCCAAGAAGCTCTCACATTGTTACAGCAGCACAGCTTAAACGAAGTAATGCAACCTCTCATCCGT
GGTCATCATCAATCACGTTCCAATAGAGAAGCCTTTTTTTGGCAATTTACTCAGGCAAAACTGCTGTTTC
AATCCAGCAAATATGAGTTAGCCAACTCACTTTTCTCATGGCTTGATAAGCAATATTCCCAATCCGTACT
CGCTCATTGGGATCCTATTCTGGAAGAACGTTTACTTGAACTGTGGCTTCAATGCCATAACAAATTATCT
AAAAAAGACCAAGACAGTCAGTTGCTAACACACATACGTGAAAGGCTCTGCTGTTTAAACCCAATACGAG
TTCTTAATTAA
 Primer design