SecReT6
Protein ID: 197336156
SecReT6 ID299
T6SS typei1
Gene symbol-
Locus tagVFMJ11_1078
StrainVibrio fischeri MJ11
Repliconchromosome I [GenBank: NC_011184] [Browse all T6SS(s) in this replicon]
Location [Strand]1132828..1133319 [-]
Producttype VI secretion lipoprotein, family
NoteTssJ
UniProt IDB5FD81
KEGG IDvfm:VFMJ11_1078
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.70E-38, Aligned region: 10..142
Protein Sequence: 163 a.a.     [Download]
>gi|197336156|ref|YP_002155799.1| type VI secretion lipoprotein, family [Vibrio fischeri MJ11]
MKQLFTFIALLLLIGCSSTPDPTYVALTLNASANVNPDHADRPSPLVVRVLELSSITGFENSEFFDLYNN
AKSTLGTDFIAEEEIILRPGDKKIIKLKLSEKGQYLAVIGAYQDIDNAKWHYIYTVEPEEAQKVELIATD
SSIVKLKRVKKKNNAPQSNNARI
 
Nucleotide Sequence: 492 bp     [Download]
>gi|197333880|ref|NC_011184.1|:c1133319-1132828 Vibrio fischeri MJ11 chromosome I, complete sequence
ATGAAACAATTATTTACCTTCATAGCTCTATTGTTACTCATTGGGTGCAGCAGCACACCTGATCCAACTT
ACGTAGCGCTTACTCTCAATGCATCTGCAAATGTTAACCCTGATCATGCAGATCGCCCCTCGCCTCTAGT
GGTAAGGGTATTAGAGTTATCTTCCATTACTGGCTTTGAAAATTCAGAATTTTTTGATTTATACAATAAT
GCAAAATCAACCTTAGGAACGGATTTTATCGCAGAAGAGGAAATCATCTTACGCCCTGGCGATAAGAAAA
TCATCAAATTAAAGCTCAGTGAAAAAGGACAATATTTAGCCGTTATCGGCGCTTATCAAGATATAGATAA
TGCAAAATGGCATTACATATACACAGTTGAGCCAGAAGAGGCGCAAAAAGTAGAATTGATCGCTACCGAC
TCTTCTATCGTCAAATTAAAACGCGTGAAAAAGAAAAATAACGCCCCACAAAGCAATAATGCGCGAATTT
AG
 Primer design