SecReT6
Protein ID: 197336290
SecReT6 ID299
T6SS typei1
Gene symbolicmF_1
Locus tagVFMJ11_1075
StrainVibrio fischeri MJ11
Repliconchromosome I [GenBank: NC_011184] [Browse all T6SS(s) in this replicon]
Location [Strand]1127127..1130648 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB5FD78
KEGG IDvfm:VFMJ11_1075
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.10E-73, Aligned region: 200..455
ImcF-related_N [PF14331], Evalue: 1.10E-73, Aligned region: 587..624
IcmF-related [PF06761], Evalue: 8.70E-68, Aligned region: 501..795
DUF1215 [PF06744], Evalue: 6.60E-30, Aligned region: 908..1025
MMR_HSR1 [PF01926], Evalue: 0.0023, Aligned region: 135..245
Protein Sequence: 1173 a.a.     [Download]
>gi|197336290|ref|YP_002155796.1| type VI secretion protein IcmF [Vibrio fischeri MJ11]
MKSFFNSLLNTLKKTWCWSLLLTLFIALLLCLFGKHIAIANTPLIETTTGKTLTVIICLLLWGAFNLTLW
GLAKREAQKEENKEAYEAAQSEMAFIREHSTILKTKLEAAIATIKRAGLYGKLNNNVKYQLPWYMVIGPQ
NSGKTTLLECSGLDFPLNQTDGHYTRDIQNSQHCEWYFANHAVLLDAAGRFFDQHENELSKPIWGNFLKA
LRNKRRRRPLNGVILTIDITTLQSPDESAIEVQARYVRERLQELRHDLSSDMPIYFLLTKMDKVEGFEPF
FSSLSREEMDQVFGVTFNEGEGQQADKIKHEFEKLILRIDSQVMSRLHDERDVMKRAELLQFPRQLSFLA
ERLALFSELAFTKTRYHQASHLRGLYLTSVPEPTNTHTESTTSGIGQNLGISSRVLPTYKHQRGFFIRKL
LEEVIFPNSELATLDEKYEKQVKLKNMAVYAASFAIVIGFGSLWATSFLTNHHKQQELLSLSSDYNQQIV
HLSPLAPSIELLPTLNTLLAATQVYSKESETLTDEFAGLQQGDKLRKAAETAYQRSLLNLLLPKVTSELE
YQVANNQDNREFLTPSLRAYLMLNLHEHLDKAYLEEWMGLHWSYLYSGSATEQKELQAHFSNLLNIEFEP
VQLNDNLIAKSRKFLREADTSELVYQQLKQDAKEMDLRDIKISDHLGPNQNLFNHTNTIIPGLYTQKGYK
AVFLSKGLDQVKQLIEENWVIGLSSDLSANEIRGLYADVEDLYFHDYIKYWKEAVDQLQIKPSKNMDEAI
LQISNITGSSQPILKLLNLIKENTTFVDKTQVASKTAGQVKKLPVNTKLKKVASLGLHSVEERSQSARKA
VSNQFEPLNLLLTDKDQATIPLEDALVVINELSGRLSMVKFSPNPDSSAFKIARDRMQGIPNELNDIRVM
AETLPQPLQQWWKQISNNAWGIILNHSRKHVQMVYHDKVVTHYDVALSGRYPFRNSSHDVNIADFDEFFQ
NGGILDNFFDAYLSSFVYKQKGKFKQKSLHGRSLGLSDSFLDQYNYGLTIQRMFYGSKGKEANVSFRIAP
FELDASALQSTFYYGKNKFAYRHGPIQKKQFTWPITNQRQYVSFVLQDLSGSKVVNQQNSGPWAFFRVLD
KFRVNKYRGQDVIKVDLENKGMKAKYLIYSDRTPNPFNRKILTNFYLPKRING
 
Nucleotide Sequence: 3522 bp     [Download]
>gi|197333880|ref|NC_011184.1|:c1130648-1127127 Vibrio fischeri MJ11 chromosome I, complete sequence
ATGAAATCATTTTTTAATTCATTGCTTAACACATTAAAAAAGACATGGTGTTGGAGCTTATTATTAACAC
TATTTATTGCCTTATTATTGTGTCTATTTGGTAAGCATATTGCGATAGCGAATACCCCATTAATTGAAAC
GACTACTGGGAAAACATTAACGGTTATCATTTGCTTGCTACTATGGGGAGCATTCAATCTGACTTTGTGG
GGCTTAGCAAAACGAGAAGCACAAAAAGAAGAAAATAAAGAAGCGTATGAAGCCGCACAATCTGAAATGG
CTTTTATTCGTGAACACAGCACCATTCTCAAAACAAAACTTGAAGCTGCAATTGCAACAATCAAGCGTGC
TGGGTTATATGGAAAACTCAATAATAACGTTAAATATCAACTTCCTTGGTATATGGTTATTGGCCCACAA
AATAGTGGTAAAACAACTCTTTTAGAGTGTTCAGGGTTAGATTTCCCTTTAAACCAAACTGATGGGCATT
ACACAAGAGACATTCAAAATAGCCAACATTGTGAATGGTATTTTGCTAACCATGCCGTTCTTTTAGATGC
TGCAGGACGCTTTTTTGATCAACATGAAAATGAGTTAAGTAAACCAATTTGGGGCAATTTTTTAAAAGCT
TTACGCAATAAGCGCCGCCGTCGCCCATTAAATGGGGTCATACTAACTATTGATATCACAACATTACAAT
CTCCAGATGAAAGTGCTATCGAAGTTCAAGCCCGCTATGTTCGTGAACGCTTACAAGAGTTAAGACATGA
TTTAAGCTCAGATATGCCTATCTATTTCTTATTAACGAAAATGGATAAAGTGGAGGGATTCGAACCCTTT
TTCTCTTCTCTATCCAGAGAGGAAATGGACCAAGTGTTTGGTGTCACTTTTAACGAAGGTGAAGGCCAAC
AAGCCGATAAAATTAAACATGAGTTCGAAAAGCTCATTTTACGTATCGATTCCCAAGTCATGTCACGCTT
ACACGATGAGCGTGATGTGATGAAACGTGCAGAGCTATTACAATTCCCACGCCAATTAAGCTTTCTTGCT
GAACGCTTAGCGTTATTTTCTGAATTAGCCTTTACTAAAACCCGTTATCACCAAGCCTCTCATTTACGCG
GTTTATACCTAACGTCAGTACCCGAACCAACAAATACCCATACTGAATCAACCACGTCAGGTATTGGGCA
AAACCTTGGGATCAGCTCTCGAGTTCTCCCTACTTATAAACATCAACGTGGGTTCTTTATTCGAAAATTA
CTCGAAGAGGTGATTTTTCCAAACAGTGAGCTCGCTACATTGGATGAAAAATATGAGAAACAAGTAAAAC
TGAAAAACATGGCGGTCTATGCAGCCTCTTTTGCTATTGTGATTGGGTTTGGTTCATTATGGGCAACCAG
CTTTTTAACCAATCATCATAAGCAACAAGAATTACTGTCTCTTTCTAGCGATTATAATCAACAGATTGTC
CATTTATCCCCTTTAGCTCCTTCTATTGAATTACTGCCAACGTTAAATACCTTATTAGCAGCAACTCAAG
TGTATTCAAAAGAGAGTGAAACGCTCACAGATGAGTTTGCGGGACTCCAACAAGGAGATAAATTACGGAA
GGCAGCAGAAACCGCGTATCAAAGAAGTTTACTGAACTTATTACTTCCTAAAGTGACAAGTGAACTCGAA
TACCAAGTGGCAAACAATCAAGATAATAGAGAGTTTTTAACGCCCTCTTTACGTGCATATTTAATGTTGA
ATCTACATGAACATCTCGATAAAGCATATCTAGAAGAATGGATGGGATTGCATTGGTCATATTTATACAG
TGGTTCAGCAACAGAACAAAAAGAACTTCAAGCGCATTTTTCTAATCTATTAAATATCGAATTTGAACCA
GTTCAATTAAACGATAATTTAATCGCTAAATCTCGTAAATTTTTACGTGAAGCAGATACATCAGAATTGG
TTTACCAACAACTGAAACAAGATGCAAAAGAGATGGATTTACGTGACATAAAAATCAGTGACCACTTAGG
ACCAAATCAAAACCTGTTCAATCATACCAATACCATTATTCCTGGTTTATATACACAAAAAGGATATAAA
GCGGTTTTTCTAAGTAAAGGATTAGACCAAGTAAAACAACTGATTGAAGAGAACTGGGTTATCGGTTTAT
CAAGTGACTTAAGTGCAAATGAGATCCGTGGACTATATGCAGATGTCGAAGACTTATATTTCCATGATTA
CATTAAATATTGGAAAGAAGCGGTAGATCAACTTCAAATTAAGCCATCTAAAAACATGGATGAAGCCATT
CTTCAGATATCGAATATTACTGGTTCAAGTCAACCAATTTTAAAACTTTTAAATCTAATAAAAGAAAACA
CCACCTTTGTTGATAAAACACAAGTTGCCTCAAAAACTGCTGGTCAAGTTAAAAAGCTCCCTGTAAATAC
AAAGCTTAAGAAAGTCGCGTCTCTAGGCTTACACAGTGTTGAGGAACGCTCTCAAAGCGCGCGTAAAGCG
GTCAGCAATCAATTTGAACCACTTAATCTTTTACTCACAGATAAAGATCAAGCAACGATTCCATTAGAAG
ATGCACTAGTTGTGATCAATGAATTGAGTGGCCGATTATCTATGGTGAAGTTCTCACCTAACCCTGATTC
ATCAGCCTTTAAGATTGCTCGCGATCGCATGCAAGGAATACCAAATGAGTTAAATGATATACGTGTAATG
GCAGAAACGCTTCCCCAACCATTACAGCAATGGTGGAAACAAATATCAAATAACGCTTGGGGTATCATAC
TGAACCATTCAAGAAAACATGTACAAATGGTTTACCATGATAAAGTCGTTACTCATTACGATGTCGCTTT
ATCTGGTCGATACCCATTTAGAAATAGTAGCCATGATGTAAACATTGCTGACTTTGATGAATTCTTCCAA
AATGGCGGTATTTTAGACAATTTCTTTGACGCCTATTTATCCTCATTTGTTTATAAGCAAAAAGGAAAAT
TTAAACAGAAATCTTTGCACGGACGTTCATTAGGACTGTCTGATTCATTCTTAGACCAATATAACTATGG
ATTGACGATTCAACGCATGTTTTATGGTTCAAAAGGAAAAGAAGCCAATGTCTCGTTCCGTATTGCGCCA
TTTGAACTGGATGCAAGTGCCTTGCAATCCACTTTCTATTACGGAAAAAACAAATTTGCTTACCGTCATG
GTCCAATACAGAAAAAACAATTTACGTGGCCAATAACCAATCAGCGTCAATACGTCAGTTTTGTTTTACA
AGATCTGAGTGGTTCTAAAGTCGTAAACCAACAAAACTCAGGTCCTTGGGCTTTCTTCCGAGTATTAGAC
AAATTCAGAGTCAATAAATACCGAGGTCAAGATGTCATAAAAGTAGATCTGGAAAATAAAGGAATGAAAG
CCAAATACCTTATTTATAGTGATCGAACCCCTAATCCTTTTAATAGAAAAATATTGACGAATTTCTATCT
TCCAAAAAGGATTAATGGATGA
 Primer design