SecReT6
Protein ID: 197336298
SecReT6 ID299
T6SS typei1
Gene symbol-
Locus tagVFMJ11_1083
StrainVibrio fischeri MJ11
Repliconchromosome I [GenBank: NC_011184] [Browse all T6SS(s) in this replicon]
Location [Strand]1138954..1139994 [-]
Producttype VI secretion protein, family
NoteTssG
UniProt IDB5FD86
KEGG IDvfm:VFMJ11_1083
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-84, Aligned region: 31..332
Protein Sequence: 346 a.a.     [Download]
>gi|197336298|ref|YP_002155804.1| type VI secretion protein, family [Vibrio fischeri MJ11]
MATTNGATTSNLVSITSNQIPSQLGITIEHIGHLSLMKALDHVCHHLKTNHDEWDLDQAYDRIQFVANPS
QGFAPREIQSIKVITHDDGLPKVIMTLNMLSLIGASSPLPAFYNDYLLQDENNVLKSFLDIFHHRLHRLI
RSVWQKYRYNAAFREGANDPFSQYIFALLGLKNPELRDDDSINWSRLFPYLGLLSQRVRSANTIEALLRY
YFQHSAIHIEECILRHCSIPTQQLCELGQNNAVLSSTSVLGSSAPDRANKFRIHIKELTWDHFHSFLTDK
PNWIALNQLVQFTVKDPLDFDIQLHLKKDEPRPLTLSVDNECCLGWTSWLGSNPNEGRITLSGKTL
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|197333880|ref|NC_011184.1|:c1139994-1138954 Vibrio fischeri MJ11 chromosome I, complete sequence
ATGGCTACCACGAATGGGGCAACAACCTCTAATTTAGTTTCAATAACGTCAAATCAAATTCCTAGTCAAT
TAGGAATAACCATTGAACATATTGGACATTTATCCTTGATGAAGGCATTGGATCATGTATGTCATCACTT
AAAAACCAATCATGATGAGTGGGATCTTGATCAGGCCTATGATCGCATTCAATTTGTAGCGAACCCTTCT
CAAGGTTTCGCTCCTCGTGAGATTCAAAGTATTAAAGTAATCACTCATGATGATGGGCTACCAAAAGTCA
TTATGACGTTAAATATGCTGTCATTAATTGGTGCTTCATCGCCCTTACCTGCTTTTTATAATGATTATTT
ACTCCAAGATGAAAATAACGTTCTAAAGTCATTTCTTGATATTTTCCATCACAGATTACATCGTTTAATT
CGTAGTGTTTGGCAAAAATACCGTTATAACGCAGCGTTTAGAGAAGGCGCCAATGATCCGTTTTCACAAT
ATATCTTTGCATTACTTGGATTAAAAAATCCTGAACTGCGTGATGATGACTCAATTAACTGGTCTCGCTT
ATTTCCTTACCTTGGTTTACTAAGCCAAAGGGTAAGATCAGCAAATACAATCGAAGCGCTATTACGATAT
TACTTCCAGCATTCAGCGATACATATTGAAGAGTGCATTCTTCGTCATTGCTCAATACCAACACAACAAC
TCTGTGAATTAGGGCAGAACAATGCCGTACTTTCTAGTACCTCTGTTTTGGGCAGTAGTGCACCAGATAG
AGCAAATAAATTTCGTATACATATAAAAGAATTAACGTGGGATCACTTCCACTCTTTTTTAACCGATAAA
CCAAATTGGATCGCACTCAATCAATTAGTGCAATTTACCGTTAAAGATCCACTCGATTTTGATATTCAAC
TTCATTTAAAAAAAGATGAACCCCGTCCATTAACCTTATCAGTCGATAATGAATGCTGCTTAGGTTGGAC
GAGTTGGCTAGGTTCAAACCCAAATGAAGGACGTATTACACTTTCAGGGAAAACATTATGA
 Primer design