SecReT6
Protein ID: 197336369
SecReT6 ID299
T6SS typei1
Gene symbol-
Locus tagVFMJ11_1085
StrainVibrio fischeri MJ11
Repliconchromosome I [GenBank: NC_011184] [Browse all T6SS(s) in this replicon]
Location [Strand]1141706..1142131 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB5FD88
KEGG IDvfm:VFMJ11_1085
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.70E-18, Aligned region: 21..113
Protein Sequence: 141 a.a.     [Download]
>gi|197336369|ref|YP_002155806.1| type VI secretion system lysozyme-like protein [Vibrio fischeri MJ11]
MSNQRLFERLLSGTTQSNQSVTAQHMTESIRSHVSQLLSTRQGAALICPDLGLPDLNMSHMSPHDAILHI
KREVERVIARYETRIINPQVRYLGDIYNPLRLYFDVRGDVIINGQNTAISFTAHAQAANRKAETNITQGA
A
 
Nucleotide Sequence: 426 bp     [Download]
>gi|197333880|ref|NC_011184.1|:c1142131-1141706 Vibrio fischeri MJ11 chromosome I, complete sequence
ATGTCGAACCAACGATTATTTGAACGACTATTAAGTGGTACAACACAAAGCAATCAATCTGTCACAGCTC
AGCATATGACAGAATCAATTCGCTCACACGTCAGTCAGTTACTTTCAACAAGACAAGGAGCTGCATTGAT
CTGTCCTGATTTAGGCTTGCCAGATCTTAATATGTCTCACATGAGTCCGCATGATGCCATCCTTCATATC
AAACGCGAGGTTGAACGAGTTATCGCTCGCTATGAAACGAGAATCATTAATCCTCAAGTTCGTTATTTGG
GGGATATCTATAATCCTTTACGTCTCTATTTTGATGTGAGAGGTGATGTCATCATCAATGGGCAAAATAC
CGCTATTTCATTTACCGCTCATGCTCAGGCTGCTAACCGCAAAGCTGAAACCAATATTACACAAGGTGCA
GCATGA
 Primer design