SecReT6
Protein ID: 197336804
SecReT6 ID300
T6SS typei1
Gene symbolicmF_2
Locus tagVFMJ11_A0817
StrainVibrio fischeri MJ11
Repliconchromosome II [GenBank: NC_011186] [Browse all T6SS(s) in this replicon]
Location [Strand]899394..902792 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB5EUJ8
KEGG IDvfm:VFMJ11_A0817
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.90E-52, Aligned region: 154..409
IcmF-related [PF06761], Evalue: 1.20E-47, Aligned region: 486..756
DUF1215 [PF06744], Evalue: 8.50E-31, Aligned region: 866..986
Protein Sequence: 1132 a.a.     [Download]
>gi|197336804|ref|YP_002158366.1| type VI secretion protein IcmF [Vibrio fischeri MJ11]
MIKNTLARTPFILSTVISAFFALLLVGVYYLWFNQADLRLLWGMLGIIFSIYAIFNLTLYIKKRKNKSHQ
NIETEEDTLSMVLKPLLHKAGKKPVYLVLGNKGSGKNQFLNVSNAIKPMDKVKNVKNDFFEWSESDSAVY
IKPNHRLTFQEISSNDSLLWDALINEVIKHKPRKPFAGCMLLIDFEFLIVHDDEQTDYTLNALLQRLESI
KETTGATLPLYLIMTKLDKLEGFKEYIHFSPLKSSVEFLAIPLKDAKGAILDYFRDSYKNIVKVMESNAL
DSSSYTNNPDEKQTILAFPKQFELCEKEISRIIERLNELNQGTYSIDIREVFFSSSLQGGRKYNLLAKSC
SNYFNLPIIASEHGQLTETPYFTRFLVDAKVLPESDYSAENQHYLKRIQQHSRIAFTVSAILLTSGGYFL
FQALDSNLRVINQLIQVEDTDLADYHSKDFTAKLVNAQKAISPTYSAWLNGNHALDEEILTMKVSRLEPT
TKIAYNALIAQIDEFLMPVISEGYENLLTKNQNSVSTSLPLLKGYLMLNDPSKRDIPYLKQQTFDVLSTL
SNDSITIQNTMSYLDAYFRTQFAPIDINMDLVRATRRSLLAKSNVDLVYAQILDQAKSIDLDTLDIQRAV
GFDFTNIFEKPTNDSNLQISKVYTASGFSSFYRPHIDLLSKRVIADNWVLGLSQHIIPTDDEQKDFKSDV
RKKYTDDYINYWRNALSELKIKNFSNIYDLNNAIDLISGPSSPMTTVLKQLYSNTQFSSTADITSLMDAK
KDLKGALETATDAVKEIIEPDYVLMSRVEQAFTLLNQLQISETKNSPTPWDDIVASLNQVRTYVKDIADS
PNVHQAALDAARARMNRAEADPLVRLKQIAQKSPEPVRSWLLDIVNQTWSVMIVEATKGIQTRWYSEVYS
IFKATGLNRYPFNTSATEEISLEDFEQLFATGGVLDVFIKDNLAPFYDINLWTAKRVDGQIMYLSPQFLV
QLKNYNIIRNTMINKSTNKVFIPFNAKVIDLDSSAIRANINFGSTIMSYYHGPSKVQELQWPPKGGDFEV
KFTLQDVTDEGKQHTLSKNGQWAIYRLLGESTLSDITNTNFVSHINVSGRDISMLFTPLTQNNPFTFAEL
ANFKLPEVINKK
 
Nucleotide Sequence: 3399 bp     [Download]
>gi|197336667|ref|NC_011186.1|:899394-902792 Vibrio fischeri MJ11 chromosome II, complete sequence
ATGATTAAAAATACTTTGGCTAGAACACCTTTCATTTTATCGACAGTAATTTCAGCATTTTTTGCATTAC
TTTTAGTTGGCGTATATTACTTATGGTTCAATCAAGCAGACCTACGTTTATTATGGGGGATGCTTGGTAT
AATTTTTTCCATCTACGCTATTTTTAACCTGACTCTTTACATAAAAAAGCGTAAAAACAAAAGCCACCAA
AATATCGAAACAGAAGAAGATACACTATCTATGGTTTTAAAGCCTCTGCTTCATAAAGCAGGAAAGAAAC
CAGTGTATCTTGTTCTTGGTAATAAAGGATCGGGTAAAAATCAATTCTTAAATGTTTCAAACGCCATTAA
ACCAATGGATAAAGTAAAAAACGTTAAAAATGATTTCTTTGAATGGTCAGAATCAGATTCAGCTGTATAC
ATCAAGCCTAACCATCGACTAACTTTTCAAGAAATATCAAGTAATGATAGCTTGCTGTGGGATGCTTTAA
TTAATGAAGTGATCAAACATAAACCTCGTAAACCTTTTGCGGGCTGTATGCTATTGATTGACTTTGAATT
TTTAATCGTACATGACGATGAACAAACTGATTACACATTAAACGCCCTACTCCAACGACTGGAATCTATA
AAAGAAACAACAGGTGCAACATTACCTCTGTACCTTATTATGACCAAGTTAGATAAATTGGAAGGTTTTA
AAGAATACATTCACTTCAGCCCTCTTAAATCGAGCGTTGAGTTTTTAGCTATTCCGCTCAAAGACGCGAA
AGGTGCAATTTTAGATTATTTCCGCGACAGCTATAAAAACATAGTGAAAGTAATGGAATCTAATGCCCTT
GACTCATCGTCGTACACTAATAATCCTGATGAAAAGCAAACAATCTTAGCTTTTCCTAAACAATTTGAAC
TGTGTGAGAAAGAAATATCGCGCATAATCGAACGATTAAACGAATTAAATCAAGGTACTTACTCCATTGA
TATTCGAGAAGTTTTTTTCAGTTCTAGTTTACAAGGTGGTAGAAAATATAACTTACTAGCGAAAAGCTGT
AGCAACTATTTCAATTTACCGATTATTGCATCTGAGCACGGACAATTAACTGAGACGCCTTATTTTACCC
GTTTCTTAGTCGATGCTAAGGTGTTGCCTGAATCTGATTATTCTGCTGAAAACCAGCATTATTTAAAACG
TATTCAGCAACATAGTCGTATCGCTTTTACTGTTTCAGCTATCCTACTTACTAGTGGTGGATATTTCTTA
TTCCAAGCACTTGATAGTAATTTACGAGTTATTAACCAATTAATTCAAGTTGAAGATACAGATCTTGCTG
ATTACCACAGTAAAGATTTCACAGCGAAACTAGTAAATGCTCAAAAAGCAATCTCACCAACTTATTCAGC
ATGGTTAAATGGAAATCATGCGTTAGATGAAGAAATTCTAACCATGAAAGTAAGTCGTTTAGAGCCTACA
ACAAAAATTGCATATAATGCTCTAATTGCGCAAATTGACGAATTTTTAATGCCTGTCATTTCTGAAGGCT
ATGAGAATTTATTAACTAAAAATCAGAATTCAGTTTCTACGTCATTACCTTTATTAAAAGGATATTTGAT
GCTGAATGATCCAAGTAAGCGTGACATTCCTTATTTAAAACAGCAAACATTTGATGTGTTATCAACGTTA
AGTAATGACTCCATCACAATACAAAATACCATGAGCTATCTTGATGCGTACTTCAGAACTCAATTTGCTC
CTATTGATATAAATATGGATCTCGTTCGTGCTACCCGTCGTAGTCTATTGGCAAAATCAAATGTTGATTT
AGTCTATGCTCAAATTTTAGATCAAGCGAAAAGCATTGATTTAGATACGTTAGACATTCAAAGAGCTGTT
GGTTTTGATTTTACTAACATTTTTGAAAAACCAACTAATGATAGTAATTTGCAAATTAGCAAGGTATATA
CCGCATCTGGTTTTAGTTCATTCTATCGTCCGCACATTGACCTTTTATCAAAACGCGTTATTGCTGATAA
CTGGGTGCTTGGTTTATCTCAACACATCATCCCTACTGATGATGAACAAAAAGATTTTAAAAGTGATGTT
CGTAAAAAATACACTGATGATTACATTAACTATTGGCGTAATGCATTAAGTGAATTAAAGATTAAGAATT
TTTCAAACATTTACGATCTGAATAATGCAATCGATCTTATTTCTGGACCATCATCTCCGATGACGACCGT
ATTAAAACAACTGTATTCGAACACACAGTTTTCCTCAACGGCTGATATCACTTCTTTGATGGATGCAAAA
AAAGATCTAAAAGGCGCTTTAGAAACAGCAACGGATGCAGTTAAAGAGATTATAGAGCCTGACTACGTTT
TAATGTCTCGCGTAGAACAAGCCTTCACTTTGCTTAACCAACTACAAATCAGTGAAACAAAAAACTCACC
TACTCCATGGGATGATATTGTTGCTTCATTAAACCAAGTAAGAACGTATGTAAAAGATATAGCTGATTCG
CCTAACGTACATCAAGCGGCCTTAGATGCAGCTAGAGCTCGAATGAACAGAGCTGAGGCTGATCCATTAG
TACGATTAAAACAAATCGCACAAAAATCACCAGAGCCGGTACGAAGCTGGCTATTAGATATTGTAAACCA
AACTTGGTCAGTAATGATCGTAGAGGCAACGAAAGGGATTCAAACTCGTTGGTATAGCGAAGTTTATAGT
ATTTTTAAAGCTACAGGATTAAATCGTTATCCATTTAATACTTCAGCTACAGAGGAAATTTCTCTTGAAG
ATTTTGAACAGTTATTTGCAACTGGCGGTGTACTCGATGTATTTATTAAAGATAACTTAGCACCATTTTA
TGACATTAATTTGTGGACAGCTAAACGCGTTGATGGACAAATAATGTATTTATCTCCTCAATTTTTAGTT
CAATTGAAAAACTACAATATTATTCGTAATACGATGATCAACAAAAGTACAAATAAGGTATTTATTCCTT
TTAATGCGAAAGTCATCGACTTAGATTCAAGTGCCATTAGAGCCAATATTAACTTTGGCAGCACAATTAT
GAGCTACTACCATGGACCAAGTAAGGTACAAGAACTTCAGTGGCCACCAAAAGGTGGTGATTTTGAAGTT
AAATTTACCCTGCAAGATGTGACTGATGAAGGAAAGCAGCACACTTTATCTAAAAATGGTCAATGGGCTA
TTTATCGCCTACTAGGCGAATCAACCTTATCTGACATTACAAATACAAATTTTGTGAGTCATATAAATGT
GTCAGGACGTGACATAAGCATGCTATTTACGCCTTTGACACAAAACAACCCTTTTACTTTCGCCGAGCTT
GCAAACTTTAAGCTACCAGAAGTAATAAACAAAAAATAA
 Primer design