SecReT6
Protein ID: 197363522
SecReT6 ID297
T6SS typei3
Gene symbol-
Locus tagSSPA2314
StrainSalmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
Repliconchromosome [GenBank: NC_011147] [Browse all T6SS(s) in this replicon]
Location [Strand]2576225..2580085 [-]
Productinner membrane protein
NoteTssM
UniProt IDB5BDU2
KEGG IDsek:SSPA2314
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.50E-93, Aligned region: 585..913
ImcF-related_N [PF14331], Evalue: 2.80E-92, Aligned region: 260..538
DUF1215 [PF06744], Evalue: 1.50E-32, Aligned region: 443..479
DUF1215 [PF06744], Evalue: 1.50E-32, Aligned region: 1022..1143
Protein Sequence: 1286 a.a.     [Download]
>gi|197363522|ref|YP_002143159.1| inner membrane protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601]
MQKFLSLLFSRRALAIVGVLVLALLVWFVGPLVSFDTLRPLASVGSRVVTIALLLMLLVLWLVNWSMSII
GISVLCLAIGFVTPLLALGDVHPFAPLWVRLTLIGFILLVYALYGLYRLWRALRMDEQLLRRFLHPRGEE
VPVAGEIKADLRTVNHIVTQAIRQLRVDMPGWRKIFEGKRFLYELPWFMVVGSPGDGKTTALLNTGLQFP
LAEQMEQTSRILTVPGGGTLHCDWWFTNEAVLIDTAGRYARHDDGGEASAAQRNAGEWQGFLGLLRKHRP
GAPLNGVILTLNVADLTAQSPAERLAACAALRARLAELRETLGIRFPVYLVVTKMDLLPGFSEYFRTLTS
HLRAQIWGFTLPYSRRRKAGDPQALHAACAQELARLTLRLDQGLDTRLQEEYDLKSRQRLYTFPREFAAL
GEPLLEAIEQIFLDSKFDATQLNNTLRGVFFTSAAQAQADAVADQLSIWQRFVRAIKTARGESSASLPHA
LPDGNRSYFLHDLLTQFIFREAHLVEPNLQWAWRYRLLRLGGHLLVLVLAFLLWQGMQTSQQTNGDYLNE
ISARATRLDGEVKAYTGKPAMAPVPALLDSARELSAWPELDPDAPPLTWRYGLYSVPPVTDSVASLYNRL
LDQLLLPPLVKRMEYVLADAIARQDSKAAYDALRIYLLLNLDKDHEDKYNAAEIQSWVINDLGNSDSVAG
FGGRAAVLTHIEALFDGSRVVHSPYEKDEALIRQARAFLDGHTSTERIYARALAAMESEAPQEFTLVRAV
GADAGTVFVRSNGAPLDRGVPGIFTREGYRELFDKRLPEFVAAATANDGWVMGRESTPKKLTDSLRSQIP
GQEQSVAREVRRLYLTEYARRWQDFLDSIHSINSAGEEGSSGLAYDLQVLRTLASPDSPLMRLGKAVVEQ
TTLAPPPDPQARQKQLAQRASGNAGKVVQTAKLFQDIHPEERLEKTLVDDRFAALREVIAGRTDGGQSGG
GTMQIASLLTMLNEYYTQLTIADSALAAGTLPARITAADKLQLEAAKLPAPLKNILLDLTKQGTRKINAG
TGDVLNTQMEAMMGDDCRDAIDGRYPFADSPQEVSAEDFNRIFASGGVLDAFWSKQLAPLADTASDPWRY
KPTEGNMTLQGPDLTPFQQAKQIRSVFFNSEGGKKFSWSMQISVVDMDPAITELVIDIDGQVLRYAHGPD
RPLKVTWPGPRNGSMAEITASPRIRQDTSTLLTGGPWALFHLLDAGMVQETAVRGRQLVEYDFDGRRVVL
EITAGRDFNPVSRELLQNFSCPARAL
 
Nucleotide Sequence: 3861 bp     [Download]
>gi|197361212|ref|NC_011147.1|:c2580085-2576225 Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601 chromosome, complete genome
ATGCAAAAATTTCTTAGTCTGCTTTTTTCCCGGCGCGCGCTGGCGATTGTGGGCGTTCTGGTTCTGGCGC
TGCTGGTCTGGTTTGTCGGGCCGCTGGTGTCATTTGATACCCTGCGCCCGCTGGCCTCCGTGGGCAGCCG
GGTGGTGACCATTGCCCTGTTGCTGATGTTGCTGGTACTGTGGCTGGTCAACTGGTCGATGAGTATCATC
GGCATCAGTGTCCTGTGCCTGGCGATTGGCTTCGTCACACCGCTGCTGGCCCTGGGCGATGTCCATCCGT
TTGCGCCGCTGTGGGTCCGCCTGACATTAATTGGTTTCATCCTGTTGGTGTATGCGCTGTACGGCCTGTA
CCGGCTGTGGCGTGCGCTGCGTATGGATGAACAACTGCTGCGTCGCTTCCTGCATCCGCGCGGGGAAGAG
GTACCGGTGGCAGGCGAGATCAAAGCCGACCTGCGCACCGTCAACCATATTGTCACGCAGGCCATCCGGC
AGCTGCGGGTGGATATGCCTGGCTGGCGTAAAATCTTCGAGGGTAAACGCTTTCTGTATGAGCTGCCGTG
GTTCATGGTGGTCGGCAGTCCCGGCGACGGCAAAACCACGGCCCTGCTGAACACCGGATTGCAGTTCCCG
CTGGCGGAGCAAATGGAGCAGACTTCGCGCATCCTGACAGTACCGGGTGGCGGCACGCTACACTGCGACT
GGTGGTTTACCAACGAAGCGGTGTTGATTGATACCGCCGGACGCTACGCCCGCCACGATGACGGTGGTGA
AGCGAGCGCCGCGCAGCGTAACGCCGGAGAGTGGCAGGGCTTTCTCGGTCTGCTGCGTAAACATCGCCCC
GGCGCGCCGCTTAACGGCGTGATCCTGACGCTAAACGTGGCGGATTTAACCGCACAGTCACCGGCGGAAC
GCCTGGCGGCCTGCGCCGCTCTGCGGGCGCGACTGGCAGAACTGCGCGAGACCCTGGGGATTCGCTTTCC
GGTCTATCTGGTGGTCACCAAAATGGATTTGTTGCCGGGGTTCAGCGAATATTTTCGCACGCTGACCAGC
CATCTTCGCGCACAAATCTGGGGCTTTACGTTGCCGTACAGCCGCAGGCGAAAAGCGGGCGACCCGCAGG
CGCTGCACGCCGCCTGCGCGCAGGAGCTGGCGCGCCTGACGCTGCGGCTGGATCAGGGACTGGATACCCG
GTTACAGGAAGAGTACGACCTTAAAAGCCGCCAGCGGCTGTATACCTTCCCGCGTGAGTTCGCCGCCCTC
GGCGAGCCGTTGCTGGAGGCTATTGAACAGATCTTCCTCGATTCAAAATTCGATGCCACGCAACTGAATA
ACACGCTGCGCGGGGTGTTTTTCACCAGTGCCGCGCAGGCGCAGGCCGACGCCGTGGCCGACCAGTTGAG
TATCTGGCAGCGCTTTGTCCGGGCGATAAAAACCGCCCGTGGCGAATCATCCGCCTCTCTCCCACACGCT
CTGCCGGACGGCAACCGCAGCTACTTTCTGCATGATCTGCTAACACAGTTTATTTTCCGTGAAGCGCACC
TGGTGGAGCCAAACCTCCAGTGGGCCTGGCGTTACCGCCTGCTGCGCCTCGGCGGGCACCTGCTGGTACT
GGTGCTGGCATTCCTGTTGTGGCAGGGGATGCAGACCAGCCAGCAGACCAACGGCGACTATCTGAATGAA
ATCAGCGCCCGCGCGACCCGGCTGGACGGCGAGGTGAAAGCCTACACCGGTAAACCGGCGATGGCTCCCG
TCCCGGCACTGCTGGACAGCGCAAGGGAACTGTCCGCCTGGCCGGAACTGGACCCGGACGCGCCGCCGCT
GACCTGGCGCTACGGCCTGTACAGCGTACCGCCGGTAACCGACAGCGTGGCGTCGCTGTACAACCGCCTG
CTGGATCAACTGCTGCTGCCGCCGCTGGTGAAACGGATGGAGTATGTGCTGGCGGACGCCATTGCCCGTC
AGGACAGTAAAGCGGCCTACGATGCCCTGCGCATCTATCTGCTACTGAATCTGGATAAAGATCACGAAGA
TAAATACAACGCGGCGGAGATCCAGTCGTGGGTGATTAACGATCTGGGGAACAGCGACAGCGTGGCCGGG
TTCGGCGGGCGCGCCGCCGTGCTGACGCATATCGAAGCGCTGTTTGACGGCAGCCGGGTGGTGCATTCAC
CGTATGAGAAAGATGAGGCGCTGATCCGCCAGGCGCGGGCATTCCTCGACGGTCACACCAGTACCGAGCG
TATCTATGCGCGGGCGCTGGCGGCGATGGAGAGCGAAGCGCCGCAGGAGTTCACGCTGGTACGCGCTGTG
GGCGCGGATGCGGGAACGGTGTTTGTGCGTAGCAACGGCGCGCCGCTGGATCGGGGCGTGCCGGGTATTT
TTACCCGTGAAGGTTACCGGGAGCTGTTCGACAAACGATTACCGGAATTTGTGGCGGCGGCGACGGCGAA
CGATGGCTGGGTGATGGGCCGGGAGAGTACGCCAAAAAAGCTGACTGACAGCCTGCGCAGCCAGATACCG
GGGCAGGAGCAGTCTGTCGCCCGCGAAGTCCGCCGTTTGTACCTGACAGAATATGCCCGCCGCTGGCAGG
ATTTTCTGGACAGTATCCATAGTATTAACAGTGCCGGGGAAGAGGGCAGTTCCGGCCTGGCCTATGATTT
ACAGGTGCTGCGCACCCTGGCGTCACCGGACTCACCGCTGATGCGGCTGGGAAAAGCGGTGGTGGAGCAG
ACCACGCTGGCGCCGCCGCCGGACCCGCAGGCCAGACAGAAACAGCTGGCGCAGCGCGCGTCCGGTAACG
CGGGGAAAGTGGTACAGACGGCAAAACTGTTCCAGGATATTCACCCGGAAGAACGGCTGGAAAAAACGCT
GGTGGATGATCGTTTCGCCGCGCTGCGCGAGGTCATTGCCGGGCGGACGGACGGCGGACAGAGCGGCGGT
GGGACGATGCAGATCGCTTCGCTGCTGACCATGCTCAACGAGTATTACACCCAACTGACCATTGCTGATA
GCGCGCTGGCGGCGGGGACGTTGCCAGCGCGCATTACTGCCGCAGACAAGTTGCAACTGGAGGCGGCGAA
ACTGCCCGCGCCGCTGAAAAACATCCTGCTGGATCTGACGAAGCAGGGAACGCGCAAAATCAACGCCGGG
ACCGGCGATGTGCTGAACACCCAGATGGAGGCGATGATGGGCGACGACTGCCGTGACGCCATCGACGGGC
GCTATCCGTTCGCCGACAGCCCGCAGGAGGTCAGCGCCGAGGACTTTAACCGCATCTTCGCCAGCGGCGG
CGTACTGGATGCTTTCTGGAGCAAACAACTGGCTCCGCTGGCGGACACCGCCAGCGACCCGTGGCGCTAC
AAACCGACCGAAGGCAACATGACATTGCAGGGGCCGGATTTAACGCCGTTTCAGCAGGCGAAGCAGATCC
GCAGCGTGTTTTTTAACAGCGAGGGCGGGAAAAAATTTTCCTGGTCGATGCAGATTAGCGTGGTGGATAT
GGACCCGGCCATCACGGAACTGGTGATTGATATCGACGGCCAGGTGCTGCGCTACGCCCATGGTCCGGAC
CGGCCCCTGAAAGTGACGTGGCCGGGACCGCGCAACGGCTCGATGGCGGAAATCACCGCCAGCCCGCGTA
TTCGCCAGGACACCTCAACGCTACTGACCGGCGGGCCGTGGGCGCTGTTTCATCTGCTGGACGCCGGAAT
GGTACAGGAAACGGCGGTGCGGGGGCGTCAACTGGTGGAATATGATTTTGACGGTCGCCGGGTGGTGCTG
GAAATCACCGCCGGGCGGGATTTTAACCCGGTCAGCCGGGAGCTGTTGCAGAACTTCAGTTGTCCGGCGA
GGGCGTTGTAA
 Primer design