SecReT6
Protein ID: 198244477
SecReT6 ID302
T6SS typei1
Gene symbol-
Locus tagSeD_A1218
StrainSalmonella enterica subsp. enterica serovar Dublin str. CT_02021853
Repliconchromosome [GenBank: NC_011205] [Browse all T6SS(s) in this replicon]
Location [Strand]1208040..1211501 [-]
Producthypothetical protein
NoteTssM
UniProt IDB5FRR5
KEGG IDsed:SeD_A1218
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.20E-82, Aligned region: 297..342
IcmF-related [PF06761], Evalue: 6.20E-82, Aligned region: 484..797
ImcF-related_N [PF14331], Evalue: 1.00E-59, Aligned region: 185..431
DUF1215 [PF06744], Evalue: 1.10E-33, Aligned region: 893..1012
AAA_22 [PF13401], Evalue: 0.00048, Aligned region: 120..252
AAA_22 [PF13401], Evalue: 0.00048, Aligned region: 640..662
AAA_22 [PF13401], Evalue: 0.00048, Aligned region: 835..866
AAA_19 [PF13245], Evalue: 0.007, Aligned region: 120..133
AAA_19 [PF13245], Evalue: 0.007, Aligned region: 257..285
Protein Sequence: 1153 a.a.     [Download]
>gi|198244477|ref|YP_002215070.1| hypothetical protein SeD_A1218 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853]
MPRFKVSAAWLLALAWILLLVWFWWKGPSWTLYEQRWLAPLANRWLATAAWGLIALTWLTVRVMKRLQLL
EKQQRQQRDEAQDPLSVELNTQQRYLDHWLLRLQRHLDSRRYLWQLPWYMVTGPAGSGKTTLLREGYPSD
IIYAPEALRGVEQRRYVIPHVGKQAVIFDADGLLFEQQDADILHRRLWTHMLDWLAQKRARQPLNGLILT
LDLPDLLTADKPRREHLLQILRGRLQDIRQHLHCQLPVYVVLTRLDLLHGFAALFQSLDRNDRDAILGVT
FTRHAHENDDWRTELNAFWQTWGEQLNNVLPERMLAPGSRSSLFSFVRQIQGGREPLIALLNGLLDGENM
DVMLRGVYLTSSLQRGQIDDIFMQSAARQFRLGSSPLTAWPLVDTLPYFTRNLFPQTLLAEPNLASESRV
WLMQSRRRLSVFSATGGIAALLLIIGWHHYYNNNWRSGITVLEQAKAFMSVPPPQGMDDYGNLQLPLLNP
VRDATLAYGDWGDRSRLADMGLYQGRRVGPYVEQTYLQLLEQRYLPALFNGLVKEMNAAPAESEEKLAVL
RVIRMLEDKSGRSDEVVKQYMAKRWSDKFHGQRDIQAQLMSHLDYALKHTDWHAERQAGDGDAISRWTPY
DNPVVAAQKELSKLPVYQRVYQSLKTRAMGVLPADLNLRDQVGATFDQVFTSGDDNKLIVPQFLTRYGLQ
SYFVKQRDALIELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYLSDYTATWRAGMDNLNVRNYESIAQ
LTGALEQIISGDQPLQRALTALRDNTQPAVLSEKLDDKALQEAMAEPDYQLLTRLGHEFAPENSTLAVQK
DKENTLQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPIFATRQMAKTLPAPLNRWVGKL
ADQAWHVVMVEAVHYMEVDWRDNVVKPFNEQLADNYPFNPRSQSDASLDAFERFFKPNGVLDTFYQQNLR
LFMENDLSLEDGDNNVIIREDVREQLDTAQEIREAFFSRQNGLGAQFAVETVSLSGNKRRSVLNLDGQLV
DYSQGRNYTAHLVWPNNMREGNESKLTLIGVSGGAPRSISFSGPWAQFRLFGAGQLTGVQEGTFSVRFNV
DGGAMVYRVHTDTEDNPFTGGLFSQFRLPDTLY
 
Nucleotide Sequence: 3462 bp     [Download]
>gi|198241740|ref|NC_011205.1|:c1211501-1208040 Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853 chromosome, complete genome
ATGCCCCGGTTTAAGGTTTCTGCCGCCTGGCTGCTGGCGCTGGCGTGGATTTTGCTGCTGGTATGGTTCT
GGTGGAAAGGTCCGTCATGGACGCTCTACGAGCAGCGCTGGCTGGCCCCGCTGGCGAACCGCTGGCTGGC
CACCGCCGCCTGGGGGTTGATTGCGCTGACGTGGCTGACCGTCCGGGTCATGAAGCGCCTGCAACTGCTG
GAAAAACAGCAGCGCCAGCAACGGGACGAGGCGCAGGATCCGCTCAGCGTGGAACTGAACACCCAGCAAC
GCTATCTCGATCACTGGTTACTGCGTCTGCAACGCCATCTCGACAGCCGCCGCTATCTGTGGCAGCTACC
GTGGTATATGGTCACTGGCCCGGCGGGAAGCGGTAAAACCACGCTGCTGCGCGAAGGGTATCCGTCCGAC
ATTATTTATGCCCCGGAGGCGCTGCGGGGCGTGGAGCAGCGCCGGTATGTTATCCCGCATGTGGGAAAAC
AGGCGGTGATTTTTGACGCTGACGGCCTCCTCTTTGAGCAACAGGATGCGGATATACTGCATCGCCGCCT
GTGGACCCATATGCTGGACTGGCTGGCGCAAAAACGCGCCCGGCAGCCGCTGAACGGCCTGATACTGACG
CTGGATCTGCCCGATCTTCTGACCGCCGACAAGCCACGCCGTGAGCACCTGTTGCAGATCCTGCGCGGAC
GTTTGCAGGATATACGCCAGCATCTTCACTGCCAGCTCCCCGTCTATGTGGTGCTGACCCGGCTGGATCT
ACTGCACGGTTTCGCCGCCCTGTTTCAGTCACTGGACCGCAACGATCGCGACGCCATTCTTGGCGTCACC
TTTACCCGTCATGCCCATGAAAATGACGACTGGCGTACAGAACTGAATGCCTTCTGGCAGACATGGGGCG
AACAGTTGAATAACGTCCTGCCGGAGCGGATGTTAGCCCCCGGCTCCCGCAGTTCCCTGTTCAGCTTTGT
CCGCCAGATCCAGGGGGGCCGCGAGCCGCTGATCGCCCTGCTGAACGGGCTGCTGGACGGGGAAAATATG
GATGTGATGCTGCGCGGCGTGTACCTCACCTCCTCCCTGCAACGCGGCCAGATAGACGATATTTTTATGC
AGTCCGCCGCCCGTCAGTTCCGGCTGGGCAGCAGTCCGCTGACCGCCTGGCCGCTGGTGGACACGTTACC
GTATTTCACCCGTAATCTGTTTCCGCAGACCTTACTGGCTGAGCCGAACCTCGCCAGTGAAAGCCGCGTC
TGGCTGATGCAGTCCCGCCGCCGGTTGTCCGTGTTTTCCGCCACTGGCGGCATCGCCGCCCTGCTGCTGA
TTATCGGCTGGCATCACTATTACAATAACAACTGGCGTTCCGGCATCACCGTACTGGAGCAGGCCAAAGC
TTTTATGTCGGTTCCGCCACCGCAGGGTATGGACGATTATGGCAACCTGCAACTACCGTTACTTAACCCG
GTGCGTGACGCCACGCTGGCCTACGGCGACTGGGGCGATCGCAGTCGTCTGGCCGATATGGGATTATATC
AGGGCAGGCGTGTCGGCCCATATGTGGAGCAGACCTACCTGCAACTGCTGGAGCAGCGTTACCTGCCCGC
CCTGTTTAACGGCCTGGTCAAAGAGATGAATGCCGCGCCTGCGGAGAGCGAGGAGAAGCTCGCGGTATTG
CGCGTTATCAGAATGCTGGAAGATAAAAGCGGACGCAGCGACGAGGTGGTGAAGCAGTATATGGCGAAAC
GCTGGAGCGATAAATTTCACGGCCAGCGCGATATTCAGGCACAGCTAATGTCTCATCTGGACTACGCGCT
GAAACACACCGACTGGCACGCGGAGCGTCAGGCAGGCGACGGCGACGCCATCAGCCGCTGGACGCCGTAT
GACAATCCGGTCGTGGCGGCGCAGAAAGAGCTCAGCAAACTGCCCGTCTACCAGCGCGTTTACCAGAGTC
TGAAAACGCGGGCGATGGGCGTGCTGCCCGCTGATCTGAACCTGCGTGACCAGGTGGGCGCCACGTTTGA
TCAGGTCTTTACCTCCGGGGATGATAATAAGCTCATTGTTCCGCAGTTCCTCACCCGTTACGGTCTGCAA
AGTTATTTTGTCAAACAGCGCGACGCGCTGATCGAACTGACGGCGATGGATTCCTGGGTGCTGAACCTGA
CCCGCAGCGTGAAATACAGCGACGCCGACCGGGCGGAAATCCAGCGCCAGCTCACTGAACAGTATCTCAG
CGACTACACCGCCACCTGGCGCGCCGGAATGGACAACCTTAACGTGCGCAATTACGAATCCATTGCGCAA
CTGACCGGGGCGCTGGAGCAGATCATCAGCGGCGATCAGCCGCTCCAGCGGGCGCTGACGGCACTGCGCG
ACAACACGCAGCCTGCCGTTCTCTCTGAAAAACTGGATGACAAGGCGCTTCAGGAGGCGATGGCGGAGCC
GGATTACCAGTTGCTGACCCGCCTGGGGCATGAATTTGCCCCGGAAAACAGCACGCTGGCGGTACAGAAA
GACAAAGAAAACACTCTCCAGGCGGTCTATCAGCAACTGACGGAGCTGCACCGTTACCTGCTGGCTATTC
AGAACGCGCCGGTGCCGGGAAAATCAGCGCTGAAAGCGGTGCAGCTACGGCTGGATCAGAACAGCAGCGA
TCCTATTTTCGCCACCCGCCAGATGGCGAAAACCCTGCCTGCCCCGCTCAACCGCTGGGTGGGCAAGCTG
GCGGATCAGGCCTGGCATGTGGTGATGGTGGAGGCAGTTCACTATATGGAAGTGGACTGGCGCGACAACG
TGGTCAAACCCTTTAATGAACAACTCGCCGACAATTATCCGTTTAACCCACGCTCACAGTCAGATGCGTC
GCTGGATGCGTTTGAACGCTTCTTTAAACCGAATGGCGTACTGGATACCTTTTATCAGCAGAACCTGCGT
CTGTTTATGGAAAACGATCTGAGTCTGGAGGACGGGGATAACAACGTGATTATTCGTGAGGATGTCCGGG
AGCAACTGGATACCGCACAGGAAATCCGCGAGGCGTTTTTCAGCAGACAGAACGGCCTGGGCGCGCAGTT
TGCCGTGGAAACTGTGTCGCTTTCCGGCAACAAACGGCGCAGCGTGCTGAATCTGGACGGGCAGTTAGTG
GACTACAGCCAGGGCCGCAATTACACCGCCCATCTGGTCTGGCCGAACAACATGCGTGAAGGCAATGAAA
GTAAGCTGACGCTGATAGGCGTCAGTGGCGGCGCGCCGCGCAGCATCAGTTTCAGCGGGCCGTGGGCGCA
GTTCAGGCTGTTCGGCGCCGGGCAACTTACCGGCGTTCAGGAGGGGACATTCAGCGTGCGCTTTAACGTG
GACGGCGGAGCGATGGTGTACCGGGTACATACCGATACGGAAGATAACCCCTTCACCGGCGGGCTGTTCA
GTCAGTTCCGGCTGCCGGATACCCTGTACTGA
 Primer design