SecReT6
Protein ID: 205352287
SecReT6 ID303
T6SS typei1
Gene symbol-
Locus tagSG1029
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]1114451..1114930 [-]
Producthypothetical protein
NoteTssD
UniProt IDB5R7A9
KEGG IDseg:SG1029
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.90E-29, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|205352287|ref|YP_002226088.1| hypothetical protein SG1029 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MANLIYLTLNGEKQGLISAGCCSLDSIGNKAQLLHLDHIMVYELTHGLSRDQNVNHHSVTIKKPVDKSSP
LLGKAINDNEILTCTFDFYRTNRFGINEKYYKLELKNARISDINFSIAHVVIDSKAQPQESISFIYESIN
WEHCIAGTSAFSLWDERVF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|205351346|ref|NC_011274.1|:c1114930-1114451 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
ATGGCCAATTTAATTTATTTAACACTGAACGGTGAAAAGCAAGGATTGATTTCAGCAGGTTGTTGTTCCC
TTGACTCTATCGGTAATAAAGCACAGTTACTGCACCTTGATCATATTATGGTATATGAACTGACACATGG
GTTAAGTCGGGATCAAAATGTCAATCATCATTCAGTTACGATAAAAAAACCTGTCGATAAATCATCTCCT
TTACTGGGAAAAGCAATTAACGATAATGAAATATTGACCTGCACTTTTGATTTTTATCGAACAAATCGAT
TTGGTATTAATGAAAAATATTACAAACTGGAATTAAAAAACGCCCGAATTAGTGATATTAATTTCTCGAT
TGCGCATGTAGTCATTGACAGTAAAGCACAACCTCAGGAAAGTATTTCTTTTATATATGAATCCATAAAC
TGGGAACACTGTATTGCCGGGACCAGTGCATTCAGTTTATGGGATGAGAGGGTGTTTTAG
 Primer design

Protein ID: 205352301
SecReT6 ID303
T6SS typei1
Gene symbol-
Locus tagSG1043
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]1134853..1135371 [+]
Producthypothetical protein
NoteTssD
UniProt IDB5R7C3
KEGG IDseg:SG1043
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.90E-35, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.004, Aligned region: 93..136
Protein Sequence: 172 a.a.     [Download]
>gi|205352301|ref|YP_002226102.1| hypothetical protein SG1043 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPSGQRSHKPFIF
TVALNKAVPLLYNALASGEMLPKTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQ
LLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|205351346|ref|NC_011274.1|:1134853-1135371 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
ATGCCAACACCGTGTTACATCTCAATTACGGGGCAAACCCAGGGCAATATCACCGCTGGTGCATTCACCG
CAGATTCTGTCGGCAATATCTACGTGCAGGGTCACGAGGATGAAATGCTGGTACAGGAATTCCTGCATAA
CGTGACCGTACCCACTGATCCACAGTCCGGGCAGCCGAGCGGCCAGCGTTCGCACAAGCCGTTCATTTTT
ACCGTGGCGCTGAACAAAGCCGTACCGCTGCTGTACAACGCGCTGGCGTCCGGTGAAATGCTGCCGAAAA
CCGAACTGCACTGGTGGCGTACTTCCGTTGAAGGCAAGCAGGAGCATTACTTCACCACCCGCCTGACGGA
CTCAACGATTGTGGATATGAAACTGCATATGCCGCACTGTCAGGACCCGGCAAAGCGCGAATTCACGCAG
TTGCTCGAAGTCTCGCTGGCCTACCGCAAAATCGAGTGGGAACACGTCAAATCCGGCACCTCTGGCGCGG
ATGACTGGCGCGCGCCGCTGGAAGCGTAA
 Primer design