SecReT6
Protein ID: 205352288
SecReT6 ID303
T6SS typei1
Gene symbol-
Locus tagSG1030
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]1114918..1116549 [-]
Producthypothetical protein
NoteTssA
UniProt IDB5R7B0
KEGG IDseg:SG1030
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.90E-45, Aligned region: 169..232
DUF3702 [PF12486], Evalue: 2.90E-45, Aligned region: 368..514
ImpA-rel_N [PF06812], Evalue: 4.00E-21, Aligned region: 117..176
ImpA-rel_N [PF06812], Evalue: 4.00E-21, Aligned region: 314..341
Protein Sequence: 543 a.a.     [Download]
>gi|205352288|ref|YP_002226089.1| hypothetical protein SG1030 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MAARRAASVSAGRGRSSGCSAPGNLPAFRRGHSACALTWTAERWCTGYIPIRKITPSPAGCSVSSGCRIP
CTEEAEMSQDALTHIIVTGQDPRGLPEFSALREEINKSSHPSQPELNWKLVESLALAIFKAHGVDLHTAT
YYTLARTRTHGLAGFCEGVELLAAMISHDWDKFWPQDESARTGMLDWLNSRTGNILRQQLSFSGADLPLL
YRTERALQLICDKLQQVELKRQPHVENLLYFVQNTRKRLEPPPKSSVDIPPQTTVRTLIYAPESTQPLTA
ENLPPQPELPEMKVEVHHGAVEDPEPVARATSGRTIKGFMAGVVCAAAVAAALWWWQVYPMQQQLAQVRD
TAQGAAMLWLASPELDSYGQRLQQLPDASPLQLLEAGMQMMHTADSRWPESLQQQQATAQWNEILKTRAQ
SSPQMRGWQQARQNLRDFADLMMQRETEKQGFTLSYIKTVTWQAERLLNQETPLESLLTQYQDARAQGRN
AEVLEKQINERLDGVLSRWLLLKNNVVPETATKAPPPPPPKIIVKSRRLTWPI
 
Nucleotide Sequence: 1632 bp     [Download]
>gi|205351346|ref|NC_011274.1|:c1116549-1114918 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
GTGGCGGCGCGCCGCGCAGCATCAGTTTCAGCGGGCCGTGGGCGCAGTTCAGGCTGTTCGGCGCCGGGCA
ACTTACCGGCGTTCAGGAGGGGACATTCAGCGTGCGCTTTAACGTGGACGGCGGAGCGATGGTGTACCGG
GTACATACCGATACGGAAGATAACCCCTTCACCGGCGGGCTGTTCAGTCAGTTCCGGCTGCCGGATACCC
TGTACTGAGGAAGCTGAAATGAGTCAGGACGCACTCACGCACATTATTGTTACCGGCCAGGATCCGCGCG
GCCTGCCGGAGTTCAGCGCCCTGCGGGAAGAGATCAACAAATCGTCTCACCCGTCGCAGCCGGAGCTGAA
CTGGAAACTGGTGGAATCGCTGGCGCTGGCCATTTTTAAAGCCCATGGCGTGGATCTGCACACGGCCACT
TATTACACCCTGGCGCGCACCCGCACGCACGGCCTGGCCGGATTTTGCGAAGGGGTGGAGCTACTGGCGG
CCATGATAAGCCACGACTGGGACAAATTCTGGCCGCAGGATGAGTCAGCCCGCACCGGGATGCTTGACTG
GCTTAATTCGCGCACCGGCAATATTCTGCGCCAGCAGCTGTCCTTCTCCGGCGCGGACCTGCCGTTGCTG
TACCGCACCGAACGGGCGTTACAGTTGATTTGCGACAAACTCCAGCAGGTGGAACTGAAACGCCAGCCGC
ATGTGGAGAACCTGCTTTATTTTGTGCAGAACACACGTAAGCGGCTTGAGCCGCCGCCGAAAAGCAGCGT
GGACATTCCGCCGCAGACCACCGTCAGAACGTTGATCTACGCCCCGGAGAGCACGCAGCCCCTCACGGCG
GAAAACCTTCCGCCCCAGCCTGAGTTGCCGGAAATGAAGGTGGAAGTCCACCACGGCGCGGTGGAGGATC
CAGAGCCTGTCGCCAGGGCCACGTCAGGCCGGACTATAAAAGGCTTTATGGCCGGTGTCGTCTGCGCTGC
GGCTGTCGCAGCCGCACTCTGGTGGTGGCAGGTGTACCCGATGCAACAGCAACTGGCGCAGGTAAGGGAC
ACGGCGCAGGGCGCGGCAATGCTCTGGCTGGCCTCGCCTGAACTGGACAGCTACGGGCAGCGGTTACAAC
AGCTTCCCGACGCCTCGCCGCTGCAACTGCTGGAGGCGGGGATGCAGATGATGCATACCGCAGACAGCCG
CTGGCCGGAGAGTCTGCAACAGCAGCAGGCAACAGCGCAGTGGAATGAAATCCTGAAAACCCGCGCGCAA
AGCAGCCCACAAATGCGCGGCTGGCAGCAGGCGCGCCAGAATCTGCGTGACTTTGCTGACCTGATGATGC
AGCGGGAAACGGAGAAGCAGGGCTTTACCCTCTCCTATATTAAAACGGTGACCTGGCAGGCGGAACGCCT
GCTGAACCAGGAAACGCCGCTGGAGTCCCTGCTGACGCAGTACCAAGATGCCCGCGCTCAGGGACGGAAT
GCGGAGGTGCTGGAAAAACAAATTAATGAACGGCTGGATGGGGTGTTAAGCCGCTGGCTGTTGCTGAAAA
ACAATGTAGTGCCGGAAACGGCAACTAAAGCCCCCCCCCCCCCCCCCCCGAAAATAATAGTTAAATCAAG
GAGATTAACATGGCCAATTTAA
 Primer design