SecReT6
Protein ID: 205352289
SecReT6 ID303
T6SS typei1
Gene symbol-
Locus tagSG1031
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]1116332..1119853 [-]
Producthypothetical protein
NoteTssM
UniProt IDB5R7B1
KEGG IDseg:SG1031
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.60E-81, Aligned region: 96..125
IcmF-related [PF06761], Evalue: 1.60E-81, Aligned region: 317..362
IcmF-related [PF06761], Evalue: 1.60E-81, Aligned region: 504..817
ImcF-related_N [PF14331], Evalue: 9.90E-60, Aligned region: 205..451
DUF1215 [PF06744], Evalue: 1.10E-33, Aligned region: 913..1032
AAA_22 [PF13401], Evalue: 0.00045, Aligned region: 140..272
AAA_22 [PF13401], Evalue: 0.00045, Aligned region: 660..682
AAA_22 [PF13401], Evalue: 0.00045, Aligned region: 855..886
AAA_19 [PF13245], Evalue: 0.0057, Aligned region: 139..153
AAA_19 [PF13245], Evalue: 0.0057, Aligned region: 277..305
AAA_16 [PF13191], Evalue: 0.0075, Aligned region: 117..155
AAA_16 [PF13191], Evalue: 0.0075, Aligned region: 808..904
Protein Sequence: 1173 a.a.     [Download]
>gi|205352289|ref|YP_002226090.1| hypothetical protein SG1031 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MFRLPTPRLFSTLRSALRPAMPRFKVSAAWLLALAWILLLVWIWWKGPSWTLYEQRWLAPLANRWLATAA
WGLIALTWLTVRVMKRLQLLEKQQRQQRDEAQDPLSVELNTQQRYLDHWLRRLQRHLDSRRSLWQLPWYM
VTGPAGSGKTTLLREGYPSDIIYAPEALRGVEQRRYVIPHVGKQAVIFDADGLLFEQQDADILHRRLWTH
MLDWLAQKRARQPLNGLILTLDLPDLLTADKPRREHLLQILRGRLQDIRQHLHCQLPVYVVLTRLDLLHG
FAALFQSLDRNDRDAILGVTFTRHAHENDDWRTELNAFWQTWGEQLNNVLPERMLAPGSRSSLFSFVRQI
QGGREPLIALLNGLLDGENMDVMLRGVYLTSSLQRGQIDDIFMQSAARQFRLGSSPLTAWPLVDTLPYFT
RNLFPQTLLAEPNLASESRVWLMQSRRRLSVFSATGGIAALLLIIGWHHYYNNNWRSGITVLEQAKAFMS
VPPPQGMDDYGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRVGPYVEQTYLQLLEQRYLPALFN
GLVKEMNAAPAESEEKLAVLRVIRMLEDKSGRSDEVVKQYMAKRWSDKFHGQRDIQAQLMSHLDYALKHT
DWHAERQAGDGDAISRWTPYDNPVVAAQKELSKLPVYQRVYQSLKTRAMGVLPADLNLRDQVGATFDQVF
TSGDDNKLIVPQFLTRYGLQSYFVKQRDALIELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYLSDYT
ATWSAGMDNLNVRNYESIAQLTGALEQIISGDQPLQRALTALRDNTQPAVLSEKLDDKALQEAMAEPDYQ
LLTRLGHEFAPENSTLAVQKDKENTLQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPIF
ATRQMAKTLPAPLNRWVGKLADQAWHVVMVEAVHYMEVDWRDNVVKPFNEQLADNYPFNPRSQSDASLDA
FERFFKPNGVLDTFYQQNLRLFMENDLSLEDGDNNVIIREDVREQLDTAQEIREAFFSRQNGLGAQFAVE
TVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGVSGGAPRSISFSGPWAQFRL
FGAGQLTGVQEGTFSVRFNVDGGAMVYRVHTDTEDNPFTGGLFSQFRLPDTLY
 
Nucleotide Sequence: 3522 bp     [Download]
>gi|205351346|ref|NC_011274.1|:c1119853-1116332 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
GTGTTCAGATTACCGACCCCCCGATTATTCAGCACACTGAGATCGGCACTCAGACCGGCAATGCCCCGGT
TTAAGGTTTCTGCCGCCTGGCTGCTGGCGCTGGCGTGGATTTTGCTGCTGGTATGGATCTGGTGGAAAGG
TCCGTCATGGACGCTCTACGAGCAGCGCTGGCTGGCCCCGCTGGCGAACCGCTGGCTGGCCACCGCCGCC
TGGGGGTTGATTGCGCTGACGTGGCTGACCGTCCGGGTCATGAAGCGCCTGCAACTGCTGGAAAAACAGC
AGCGCCAGCAACGGGACGAGGCGCAGGATCCGCTCAGCGTGGAACTGAACACCCAGCAACGCTATCTCGA
TCACTGGTTACGGCGTCTGCAACGCCATCTCGACAGCCGCCGCTCTCTGTGGCAGCTACCGTGGTATATG
GTCACTGGCCCGGCGGGAAGCGGTAAAACCACGCTGCTGCGCGAAGGGTATCCGTCCGACATTATTTATG
CCCCGGAGGCGCTGCGGGGCGTGGAGCAGCGCCGGTATGTTATCCCGCATGTGGGAAAACAGGCGGTGAT
TTTTGACGCTGACGGCCTCCTCTTTGAGCAACAGGATGCGGATATACTGCATCGCCGCCTGTGGACCCAT
ATGCTGGACTGGCTGGCGCAAAAACGCGCCCGGCAGCCGCTGAACGGCCTGATACTGACGCTGGATCTGC
CCGATCTTCTGACCGCCGACAAGCCACGCCGTGAGCACCTGTTGCAGATCCTGCGCGGACGTTTGCAGGA
TATACGCCAGCATCTTCACTGCCAGCTCCCCGTCTATGTGGTGCTGACCCGGCTGGATCTACTGCACGGT
TTCGCCGCCCTGTTTCAGTCACTGGACCGCAACGATCGCGACGCCATTCTTGGCGTCACCTTTACCCGTC
ATGCCCATGAAAATGACGACTGGCGTACAGAACTGAATGCCTTCTGGCAGACATGGGGCGAACAGTTGAA
TAACGTCCTGCCGGAGCGGATGTTAGCCCCCGGCTCCCGCAGTTCCCTGTTCAGCTTTGTCCGCCAGATC
CAAGGGGGCCGCGAGCCGCTGATCGCCCTGCTGAACGGGCTGCTGGACGGGGAAAATATGGATGTGATGC
TGCGCGGCGTGTACCTCACCTCCTCCCTGCAACGCGGCCAGATAGACGATATTTTTATGCAGTCCGCCGC
CCGTCAGTTCCGGCTGGGCAGCAGTCCGCTGACCGCCTGGCCGCTGGTGGACACGTTACCGTATTTCACC
CGTAATCTGTTTCCGCAGACCTTACTGGCTGAGCCGAACCTCGCCAGTGAAAGCCGCGTCTGGCTGATGC
AGTCCCGCCGCCGGTTGTCCGTGTTTTCCGCCACTGGCGGCATCGCCGCCCTGCTGCTGATTATCGGCTG
GCATCACTATTACAATAACAACTGGCGTTCCGGCATCACCGTACTGGAGCAGGCCAAAGCTTTTATGTCG
GTTCCGCCACCGCAGGGTATGGACGATTATGGCAACCTGCAACTACCGTTACTTAACCCGGTGCGTGACG
CCACGCTGGCCTACGGCGACTGGGGCGATCGCAGTCGTCTGGCCGATATGGGATTATATCAGGGCAGGCG
TGTCGGCCCATATGTGGAGCAGACCTACCTGCAACTGCTGGAGCAGCGTTACCTGCCCGCCCTGTTTAAC
GGCCTGGTCAAAGAGATGAATGCCGCGCCTGCGGAGAGCGAGGAGAAGCTCGCGGTATTGCGCGTTATCA
GAATGCTGGAAGATAAAAGCGGACGCAGCGACGAGGTGGTGAAGCAGTATATGGCGAAACGCTGGAGCGA
TAAATTTCACGGCCAGCGCGATATTCAGGCACAGCTAATGTCTCATCTGGACTACGCGCTGAAACACACC
GACTGGCACGCGGAGCGTCAGGCAGGCGACGGCGACGCCATCAGCCGCTGGACGCCGTATGACAATCCGG
TCGTGGCGGCGCAGAAAGAGCTCAGCAAACTGCCCGTCTACCAGCGCGTTTACCAGAGTCTGAAAACGCG
GGCGATGGGCGTGCTGCCCGCTGATCTGAACCTGCGTGACCAGGTGGGCGCCACGTTTGATCAGGTCTTT
ACCTCCGGGGATGATAATAAGCTCATTGTTCCGCAGTTCCTCACCCGTTACGGTCTGCAAAGTTATTTTG
TCAAACAGCGCGACGCGCTGATCGAACTGACGGCGATGGATTCCTGGGTGCTGAACCTGACCCGCAGCGT
GAAATACAGCGACGCCGACCGGGCGGAAATCCAGCGCCAGCTCACTGAACAGTATCTCAGCGACTACACC
GCCACCTGGAGCGCCGGAATGGACAACCTTAACGTGCGCAATTACGAATCCATTGCGCAACTGACCGGGG
CGCTGGAGCAGATCATCAGCGGCGATCAGCCGCTCCAGCGGGCGCTGACGGCACTGCGCGACAACACGCA
GCCTGCCGTTCTCTCTGAAAAACTGGATGACAAGGCGCTTCAGGAGGCGATGGCGGAGCCGGATTACCAG
TTGCTGACCCGCCTGGGGCATGAATTTGCCCCGGAAAACAGCACGCTGGCGGTACAGAAAGACAAAGAAA
ACACTCTCCAGGCGGTCTATCAGCAACTGACGGAGCTGCACCGTTACCTGCTGGCTATTCAGAACGCGCC
GGTGCCGGGAAAATCAGCGCTGAAAGCGGTGCAGCTACGGCTGGATCAGAACAGCAGCGATCCTATTTTC
GCCACCCGCCAGATGGCGAAAACCCTGCCTGCCCCGCTCAACCGCTGGGTGGGCAAGCTGGCGGATCAGG
CCTGGCATGTGGTGATGGTGGAGGCAGTTCACTATATGGAAGTGGACTGGCGCGACAACGTGGTCAAACC
CTTTAATGAACAACTTGCCGACAATTATCCGTTTAACCCACGCTCACAGTCAGATGCGTCGCTGGATGCG
TTTGAACGCTTCTTTAAACCGAATGGCGTACTGGATACCTTTTATCAGCAGAACCTGCGTCTGTTTATGG
AAAACGATCTGAGTCTGGAGGACGGGGATAACAACGTGATTATTCGTGAGGATGTCCGGGAGCAACTGGA
TACCGCACAGGAAATCCGCGAGGCGTTTTTCAGCAGACAGAACGGCCTGGGCGCGCAGTTTGCCGTGGAA
ACTGTGTCGCTTTCCGGCAACAAACGGCGCAGCGTGCTGAATCTGGACGGGCAGTTAGTGGACTACAGCC
AGGGCCGCAATTACACCGCCCATCTGGTCTGGCCGAACAACATGCGTGAAGGCAATGAAAGTAAGCTGAC
GCTGATAGGCGTCAGTGGCGGCGCGCCGCGCAGCATCAGTTTCAGCGGGCCGTGGGCGCAGTTCAGGCTG
TTCGGCGCCGGGCAACTTACCGGCGTTCAGGAGGGGACATTCAGCGTGCGCTTTAACGTGGACGGCGGAG
CGATGGTGTACCGGGTACATACCGATACGGAAGATAACCCCTTCACCGGCGGGCTGTTCAGTCAGTTCCG
GCTGCCGGATACCCTGTACTGA
 Primer design