SecReT6
Protein ID: 205352290
SecReT6 ID303
T6SS typei1
Gene symbol-
Locus tagSG1032
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]1119872..1121167 [-]
Producthypothetical protein
NoteTssA
UniProt IDB5R7B2
KEGG IDseg:SG1032
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.40E-09, Aligned region: 13..70
Protein Sequence: 431 a.a.     [Download]
>gi|205352290|ref|YP_002226091.1| hypothetical protein SG1032 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MLKLGSLAHSQLDIPEIQRRGLVILASESKDFRLLAHLLRTLQHAGDPLLALRLLALYVEHYWTVAAPQN
AAHKQRFATQVLKRFETGVESFAETARTAQRDSLLAELAKLAQRWQEQNIPALAQAVDDLSSQYRRAFRG
AAPVPPAAGPSTPPAPVSATPSAPVSPSAPAATTAPPVDIDSHDDKAWRDTLLKVAAILCERQPDSPQGY
RLRRHALWQAITSVPQAESDGRTPLAAVPADMTADYQARLNNADLALWQQVEKSLLLAPYWLDGHYLSAQ
AAQRLGYTSAAEAIRDEVVRFLARLPQLATLLFNDRTPFISEQTKQWLAASPGSQTAPMVRTSEDTEAVR
QCFSEQGLEATLRYLETLPEGDPRDRFHRQYLGAQLLEEAGMAQLAQQQYRMLFKAGLRMTLAEWEPSLL
EQLENKLTAEQ
 
Nucleotide Sequence: 1296 bp     [Download]
>gi|205351346|ref|NC_011274.1|:c1121167-1119872 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
ATGCTTAAACTCGGCTCGCTGGCGCACAGTCAGCTGGATATCCCGGAAATTCAGCGCCGGGGGCTGGTGA
TTCTGGCCTCGGAAAGCAAGGATTTTCGCCTGCTGGCCCATCTGCTGCGCACCCTGCAACATGCCGGCGA
TCCGCTGCTGGCGCTGCGTCTGCTGGCGCTGTACGTGGAGCATTACTGGACGGTGGCGGCACCACAAAAT
GCGGCACATAAACAGCGTTTCGCCACCCAGGTGCTGAAACGCTTTGAAACCGGCGTGGAGAGTTTCGCAG
AGACAGCCCGTACCGCGCAGCGCGACAGCCTGCTGGCTGAACTGGCGAAACTGGCGCAGCGCTGGCAGGA
GCAGAATATCCCGGCGCTGGCACAGGCCGTCGATGACCTCTCGTCGCAGTATCGCCGGGCATTTCGCGGG
GCCGCCCCGGTGCCGCCAGCGGCTGGCCCGTCCACGCCTCCGGCTCCGGTTTCGGCCACGCCGTCCGCCC
CGGTATCCCCGTCTGCGCCTGCGGCGACGACGGCGCCACCGGTGGATATCGACAGCCATGACGACAAAGC
CTGGCGCGACACGCTGCTGAAAGTGGCCGCCATTCTCTGTGAGCGCCAGCCGGATTCACCGCAGGGCTAC
CGCCTGCGCCGCCATGCGTTATGGCAGGCCATTACATCCGTCCCCCAGGCCGAAAGCGACGGGCGCACAC
CGCTGGCGGCGGTGCCTGCCGACATGACCGCCGATTACCAGGCGCGGCTGAACAACGCCGATCTGGCGCT
CTGGCAACAGGTGGAAAAAAGCCTGCTGCTGGCCCCGTACTGGCTCGATGGTCATTACCTTTCAGCGCAG
GCCGCACAACGCCTGGGCTACACCAGCGCGGCAGAAGCCATCCGGGATGAGGTGGTTCGCTTTCTCGCCC
GCCTGCCGCAACTTGCCACCCTGCTGTTTAATGACCGCACACCGTTTATCAGCGAACAGACAAAACAGTG
GCTGGCGGCGTCTCCGGGCAGTCAGACAGCCCCGATGGTGCGGACCAGTGAAGACACCGAGGCCGTCCGC
CAGTGTTTCAGCGAGCAGGGGCTGGAGGCCACGCTGCGATACCTGGAAACCCTGCCGGAAGGCGATCCGC
GCGATCGGTTCCACCGGCAGTATCTTGGCGCGCAACTGTTAGAAGAAGCCGGGATGGCGCAACTGGCACA
GCAACAGTACCGGATGTTGTTTAAAGCAGGGCTGCGCATGACGCTGGCTGAATGGGAGCCGTCCCTGCTG
GAACAACTGGAAAACAAACTCACGGCAGAACAGTAA
 Primer design