SecReT6
Protein ID: 205352292
SecReT6 ID303
T6SS typei1
Gene symbol-
Locus tagSG1034
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]1122020..1124683 [-]
ProductclpB-protease
NoteTssH
UniProt IDB5R7B4
KEGG IDseg:SG1034
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.10E-38, Aligned region: 265..265
AAA_2 [PF07724], Evalue: 3.10E-38, Aligned region: 606..767
AAA [PF00004], Evalue: 1.20E-17, Aligned region: 30..57
AAA [PF00004], Evalue: 1.20E-17, Aligned region: 223..327
AAA [PF00004], Evalue: 1.20E-17, Aligned region: 612..730
AAA [PF00004], Evalue: 1.20E-17, Aligned region: 743..803
AAA_5 [PF07728], Evalue: 4.10E-14, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 4.10E-14, Aligned region: 611..732
ClpB_D2-small [PF10431], Evalue: 1.80E-12, Aligned region: 773..849
AAA_16 [PF13191], Evalue: 2.20E-10, Aligned region: 24..75
AAA_16 [PF13191], Evalue: 2.20E-10, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 2.20E-10, Aligned region: 263..300
AAA_16 [PF13191], Evalue: 2.20E-10, Aligned region: 449..461
AAA_16 [PF13191], Evalue: 2.20E-10, Aligned region: 586..652
AAA_16 [PF13191], Evalue: 2.20E-10, Aligned region: 677..705
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 25..66
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 222..307
AAA_22 [PF13401], Evalue: 1.30E-08, Aligned region: 610..645
AAA_14 [PF13173], Evalue: 4.00E-05, Aligned region: 222..304
AAA_14 [PF13173], Evalue: 4.00E-05, Aligned region: 611..701
NACHT [PF05729], Evalue: 7.10E-05, Aligned region: 222..250
NACHT [PF05729], Evalue: 7.10E-05, Aligned region: 612..640
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 282..307
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 386..424
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 606..640
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 771..803
AAA_29 [PF13555], Evalue: 0.00016, Aligned region: 214..239
AAA_29 [PF13555], Evalue: 0.00016, Aligned region: 609..636
AAA_19 [PF13245], Evalue: 0.00025, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00025, Aligned region: 603..633
DUF258 [PF03193], Evalue: 0.00027, Aligned region: 191..239
DUF258 [PF03193], Evalue: 0.00027, Aligned region: 612..630
Clp_N [PF02861], Evalue: 0.001, Aligned region: 24..71
Clp_N [PF02861], Evalue: 0.001, Aligned region: 117..123
RuvB_N [PF05496], Evalue: 0.0033, Aligned region: 290..302
RuvB_N [PF05496], Evalue: 0.0033, Aligned region: 528..592
RuvB_N [PF05496], Evalue: 0.0033, Aligned region: 605..626
RuvB_N [PF05496], Evalue: 0.0033, Aligned region: 679..705
RuvB_N [PF05496], Evalue: 0.0033, Aligned region: 744..827
AAA_18 [PF13238], Evalue: 0.0039, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.0039, Aligned region: 612..647
Zeta_toxin [PF06414], Evalue: 0.0056, Aligned region: 222..241
Zeta_toxin [PF06414], Evalue: 0.0056, Aligned region: 610..651
AAA_17 [PF13207], Evalue: 0.0071, Aligned region: 222..263
AAA_17 [PF13207], Evalue: 0.0071, Aligned region: 612..646
Arch_ATPase [PF01637], Evalue: 0.0088, Aligned region: 202..236
Arch_ATPase [PF01637], Evalue: 0.0088, Aligned region: 275..308
Arch_ATPase [PF01637], Evalue: 0.0088, Aligned region: 612..632
Arch_ATPase [PF01637], Evalue: 0.0088, Aligned region: 682..693
Protein Sequence: 887 a.a.     [Download]
>gi|205352292|ref|YP_002226093.1| clpB-protease [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MIQIDLATLVKRLAPFAKQALEAAASECMSQQAAEITVAHVLLQMLATPRSDFRVIAERAEIGADDLRQA
LTVENYATARSSDSYPSFSPMLVEWLKEAWLLASAEMQQTELRGGVLLLALLHSPLRYLPPAAARLLTAI
NRDLLRQDFAGWTKESAESVILNADGQTASAIADTGDTLLARYAKNMTDDARQGRLDPVLCRDNEIDLMI
DILCSRRKNNPVVVGEAGVGKSALIEGLALRIIAGQVPDKLRDTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVIQSPKPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDSGLSA
VYEQSHGVLIDDEALQAAATLSERYLSGRQLPDKAIDVLDTACARVAINLSSPPRQISALTPLRQQCEAE
IRQLEREIRIGLRSDTSRLNEVLAQYDETLSELDALEAAWRQQQTLVQEIIALRKGLLDETDATGNDETA
TPETEAVGSDDESVTAPPEAEPEISPAARLAQLTAELDALHHTQLLVSPHVDKKQIASVIAEWTGVPLNR
LSQNEMSVITDLPQWLGDTIKGQALAIKHLHKHLLTARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAE
LLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLF
YQAFDKGEMADGEGRLIDCKNVVFFLTSNLGYQVIVEHADNPEAMQEALYPVLADFFKPALLARMEVVPY
LPLSRETLAVIIAGKLARLDNVLRARFGAEVVIEPEVTDEIMQRVTRAENGARMLESVIDGEMLPPLSLL
LLQKMAANIAIARITLGVANGAFTADVEDVPDEDTQPVAEAEDEAVL
 
Nucleotide Sequence: 2664 bp     [Download]
>gi|205351346|ref|NC_011274.1|:c1124683-1122020 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
ATGATCCAGATTGACTTAGCCACCCTGGTAAAACGGCTTGCTCCCTTCGCGAAACAGGCGCTGGAAGCGG
CGGCGTCGGAGTGTATGAGCCAGCAGGCGGCAGAAATTACCGTCGCGCATGTGCTGCTACAGATGCTGGC
GACCCCGCGCAGCGACTTTCGGGTGATTGCCGAACGTGCGGAGATCGGCGCCGATGATTTACGCCAGGCG
CTGACGGTGGAAAATTACGCCACCGCCCGTTCATCCGACAGCTACCCGTCGTTTTCCCCGATGCTGGTTG
AATGGCTGAAAGAGGCCTGGCTGCTGGCCTCCGCGGAAATGCAGCAGACCGAACTGCGCGGCGGCGTGCT
GCTGCTCGCCCTGCTGCATTCGCCGTTGCGCTACCTGCCGCCCGCCGCCGCCCGGTTGCTGACCGCCATC
AACCGCGACCTGCTCCGGCAGGATTTTGCCGGGTGGACGAAGGAGTCCGCCGAATCGGTGATCCTGAATG
CGGACGGACAGACCGCCAGCGCCATAGCCGATACCGGCGACACCCTGCTGGCCCGCTATGCCAAAAACAT
GACCGACGATGCCCGGCAGGGGCGGCTTGATCCGGTGCTGTGCCGCGATAACGAAATTGACCTGATGATC
GATATCCTCTGCAGCCGCCGTAAAAATAATCCGGTGGTGGTGGGCGAAGCGGGCGTGGGCAAAAGCGCGC
TGATTGAAGGGCTGGCGCTGCGCATTATTGCCGGTCAGGTGCCGGACAAACTGCGCGATACCGATATTAT
GACGCTGGATCTCGGCGCATTACAGGCGGGCGCGTCGGTGAAAGGTGAATTTGAGAAGCGCTTTAAGGGG
CTGATGGCGGAAGTCATTCAGTCGCCGAAACCCGTCATCCTGTTTATCGACGAAGCCCACACGCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTCAAACCGGCACTGGCGCGCGGCGAGCT
GAAAACCATCGCCGCCACCACCTGGAGCGAATACAAAAAATACTTCGAGAAAGACTCCGGCCTGTCGGCG
GTGTATGAGCAGTCCCACGGCGTGCTGATTGACGATGAAGCCTTACAGGCCGCTGCGACGTTGAGCGAGC
GCTACCTGTCAGGCCGCCAGTTGCCGGATAAGGCCATTGATGTGCTGGATACCGCCTGCGCCCGCGTGGC
GATTAACCTCTCCTCGCCGCCGAGACAAATCTCGGCGCTGACCCCCCTGCGCCAGCAGTGTGAAGCGGAA
ATCCGCCAGCTTGAGCGTGAGATCCGTATTGGCCTGCGGTCGGACACCTCACGGCTAAACGAGGTTCTGG
CGCAGTATGACGAAACGCTGAGCGAACTGGATGCGCTGGAGGCCGCGTGGCGCCAGCAGCAGACGCTGGT
GCAGGAGATTATCGCGCTGCGTAAGGGGCTGCTGGACGAAACGGATGCTACCGGCAACGACGAAACCGCA
ACGCCTGAAACAGAGGCGGTGGGCAGTGACGATGAATCCGTCACAGCGCCGCCGGAAGCGGAACCGGAAA
TTTCGCCAGCCGCCCGCCTCGCGCAGCTCACCGCCGAACTGGACGCCCTGCACCACACGCAGCTGCTGGT
CTCCCCACACGTCGATAAAAAACAGATAGCCAGCGTGATTGCCGAATGGACCGGCGTGCCGCTTAACCGC
CTGTCACAAAACGAAATGTCGGTCATCACCGACCTGCCGCAGTGGCTGGGCGACACCATTAAAGGCCAGG
CGCTGGCGATTAAGCACCTGCACAAACACCTGCTGACCGCCCGCGCCGATCTGCGCCGTCCGGGACGCCC
GCTCGGCGCGTTCCTGCTGGCCGGTCCCAGCGGTGTCGGCAAAACCGAAACCGTGCTGCAACTGGCCGAA
CTGCTCTACGGCGGTCGCCAGTACCTGACCACCATCAATATGTCGGAGTTTCAGGAGAAACACACCGTTT
CACGACTGATTGGTTCGCCGCCGGGCTATGTCGGCTACGGCGAGGGCGGCGTGCTGACCGAAGCGATTCG
TCAGAAACCGTACTCCGTGGTGCTGCTCGACGAGGTGGAGAAAGCCCACCCGGACGTGCTCAACCTGTTC
TACCAGGCGTTCGACAAGGGCGAGATGGCCGATGGCGAAGGGCGTCTTATCGACTGTAAAAATGTGGTGT
TCTTCCTCACCTCCAACCTCGGCTATCAGGTGATTGTCGAACATGCCGACAACCCGGAAGCCATGCAGGA
AGCGCTGTACCCGGTACTGGCGGACTTCTTTAAACCGGCGCTGCTGGCGCGTATGGAAGTGGTGCCGTAC
CTGCCGTTATCCAGAGAAACGCTTGCCGTCATTATCGCCGGGAAGCTGGCGCGGCTGGACAACGTACTGC
GCGCCCGCTTCGGCGCGGAGGTGGTGATTGAGCCGGAGGTGACCGACGAAATCATGCAGCGCGTCACCCG
CGCCGAAAACGGCGCGCGGATGCTGGAGTCGGTCATCGACGGCGAGATGCTGCCGCCGCTCTCCCTGCTG
CTGTTGCAGAAAATGGCGGCGAATATCGCCATTGCCCGTATCACGCTGGGCGTGGCAAACGGCGCGTTTA
CCGCGGATGTGGAGGATGTGCCGGATGAGGATACTCAGCCCGTAGCGGAAGCAGAGGACGAAGCCGTTCT
ATGA
 Primer design