SecReT6
Protein ID: 205352293
SecReT6 ID303
T6SS typei1
Gene symbol-
Locus tagSG1035
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]1124696..1125454 [-]
Producthypothetical protein
NoteTssL
UniProt IDB5R7B5
KEGG IDseg:SG1035
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.40E-63, Aligned region: 30..234
Protein Sequence: 252 a.a.     [Download]
>gi|205352293|ref|YP_002226094.1| hypothetical protein SG1035 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MDELSLPPLPGYEREGQRQYQLALRGNSLNPMIDAATPLLGMVMRVSGMNSHAMPEHLFTQVVTDVQAVE
QLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLMREPK
RYQDLLEFLYICFSLGFRGRYKVAVQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLIKR
LTIRHVLCGGIVVLALFYLFYLLRLDSQTQDILHQLNRLLAR
 
Nucleotide Sequence: 759 bp     [Download]
>gi|205351346|ref|NC_011274.1|:c1125454-1124696 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
ATGGATGAGCTGTCACTGCCCCCTTTACCCGGATACGAGAGAGAAGGCCAGCGCCAGTATCAGCTGGCGC
TGCGCGGCAACAGCCTGAACCCGATGATCGATGCCGCCACCCCGCTGCTGGGGATGGTGATGCGCGTTTC
GGGCATGAACAGCCATGCCATGCCTGAACACCTGTTCACCCAGGTGGTGACGGATGTGCAGGCGGTGGAG
CAGTTACTCCAGGAGCAGGGCTATGAGCCTGGGGTGATTATCTCGTTTCGTTACATCCTGTGTACCTTTA
TTGACGAGGCGGCGCTGGGGAATGGCTGGTCGAACAAAAACGAGTGGATCAAGCAGTCGCTGCTGGTGCA
TTTCCATAACGAAGCCTGGGGCGGTGAAAAGGTTTTTATCCTGCTGGAGCGCCTGATGCGCGAACCCAAA
CGCTACCAGGATCTGCTGGAATTTTTGTACATCTGCTTTTCGCTGGGCTTTCGCGGGCGTTATAAAGTCG
CCGTCCAGGACCAGGGGGAGTTTGAGCAGATATACCGCCGCCTGTATCACGTCCTGCATAAGCTGCGCGG
CGATGCGCCCTTTCCGCTGCTGCACCAGGATAAAAAAACCCAGGGCGGGCGCTATCAGCTGATTAAACGG
CTGACCATCCGGCATGTTCTGTGCGGCGGCATCGTCGTACTGGCGCTGTTTTATCTGTTTTATCTGCTGC
GTCTGGACAGTCAGACGCAGGACATTCTTCATCAGTTAAACCGGCTGCTTGCCAGGTAA
 Primer design