SecReT6
Protein ID: 205352294
SecReT6 ID303
T6SS typei1
Gene symbol-
Locus tagSG1036
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]1125459..1126790 [-]
Producthypothetical protein
NoteTssK
UniProt IDB5R7B6
KEGG IDseg:SG1036
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-146, Aligned region: 20..442
Protein Sequence: 443 a.a.     [Download]
>gi|205352294|ref|YP_002226095.1| hypothetical protein SG1036 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MATTRNKVMWREGTLMRPHHLQQQQRYNDYVNNLRFRAIHDLSWGFTELSLNDELLGQGKIMIDSASGTL
PDGTVFSLPDQDALPDPLHPDSFPDEESRNVYLALPVASDVRGEVSYGQQVGRYRLNDASVRDLHSENGD
ARTLTLGQLPPRIMSGADDMSAYVTLPLCRIKDRRADGSLMLDENFIPTCQNVYVSARLREFLREVQEAV
GGRANDLANRIGSPAQSGIADVAEFMMLQLLNRNQTRFTHRARRPHLHPEDFYLDLAGLLGELMTFTEPS
RLPCPLDVYDHRNLTDTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADVHDSTLLQSATFVLAVAA
KMETLQLQRQFIQQSKISSPEKIRNMVSVQIPGIPLHTLMVAPRQLPYHAGFSYFELDKSGAAWADVAAT
GAVALHVSGTFPDLNMQLWAIRG
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|205351346|ref|NC_011274.1|:c1126790-1125459 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
ATGGCAACCACGCGAAACAAGGTGATGTGGCGGGAAGGAACGCTGATGCGTCCGCACCATCTCCAGCAGC
AACAACGTTATAACGATTATGTGAATAATCTGCGTTTCCGGGCCATTCATGATTTGTCCTGGGGATTTAC
CGAGCTTTCCCTCAATGATGAGCTGCTGGGACAGGGCAAAATTATGATCGACAGCGCGTCGGGCACCCTG
CCGGACGGCACCGTGTTTTCCCTTCCGGACCAGGATGCGCTCCCCGATCCGCTGCATCCGGACAGTTTTC
CTGATGAAGAAAGCCGCAATGTCTATCTGGCTTTACCCGTTGCCAGCGATGTGAGAGGCGAAGTCAGTTA
CGGGCAGCAGGTTGGGCGTTACCGGCTGAACGATGCCAGTGTCCGGGATCTGCACTCCGAGAATGGCGAT
GCCCGGACGCTGACGCTGGGCCAGTTGCCCCCCCGCATTATGAGCGGAGCGGACGATATGAGCGCGTATG
TCACGTTGCCGCTGTGCCGTATCAAAGACAGGCGTGCGGACGGCTCCCTGATGCTGGATGAAAACTTTAT
CCCTACCTGCCAGAACGTTTATGTCAGCGCACGGCTGCGTGAATTTCTCCGGGAAGTCCAGGAAGCGGTT
GGCGGCCGGGCCAATGACCTGGCTAACCGCATTGGCTCTCCGGCGCAAAGCGGTATTGCCGACGTTGCGG
AATTTATGATGCTGCAACTGCTCAACCGTAACCAGACGCGGTTCACCCACCGCGCCCGCAGGCCGCACCT
CCATCCGGAAGATTTTTATCTCGATCTGGCCGGACTGCTGGGCGAGCTGATGACATTTACCGAGCCATCC
CGCCTGCCCTGTCCGCTGGATGTCTACGATCACCGTAACCTGACGGACACCTTCAAAACGCTGTTGCCGG
AAGTGAAACGGGCATTACATACCGTCCTGTCGCCCAGGGCGGTTAACCTGCCGCTGCATCTGCGCGATGG
CATCTGGCAGGCTGACGTACATGACTCCACGCTGTTGCAGTCGGCCACCTTCGTGCTGGCGGTGGCGGCG
AAAATGGAGACGCTGCAACTCCAGCGCCAGTTTATCCAGCAGTCAAAAATTTCCTCGCCGGAAAAAATCC
GCAATATGGTCAGCGTGCAAATCCCCGGCATCCCGCTGCATACGCTGATGGTGGCGCCCCGCCAGCTTCC
GTACCATGCCGGTTTCAGCTATTTCGAACTGGACAAGAGCGGGGCCGCCTGGGCGGATGTGGCGGCCACC
GGCGCTGTCGCCCTGCATGTTTCCGGTACGTTCCCGGATCTGAACATGCAACTGTGGGCCATAAGAGGAT
AA
 Primer design