SecReT6
Protein ID: 205352295
SecReT6 ID303
T6SS typei1
Gene symbol-
Locus tagSG1037
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]1126793..1127326 [-]
Productlipoprotein
NoteTssJ
UniProt IDB5R7B7
KEGG IDseg:SG1037
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.90E-33, Aligned region: 17..170
Protein Sequence: 177 a.a.     [Download]
>gi|205352295|ref|YP_002226096.1| lipoprotein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MTGRGFLAWAMVALFTLALCGCETVKKIGEVIKNPDIQVGKLADQSSQVTITLLTEPDANINADGEAAAV
DVQLVYLSDDSKFQAADYDQIATTALPDALGKNYIDHQDFSLLPDTMKTLPPVKLDEKTQFIGVIAYFSD
DQTTEWKQIEPVEGTGHNYRLLVHIRQSSIEMKKEDD
 
Nucleotide Sequence: 534 bp     [Download]
>gi|205351346|ref|NC_011274.1|:c1127326-1126793 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
ATGACAGGCCGTGGTTTCCTCGCCTGGGCGATGGTGGCGTTGTTCACCCTCGCCTTATGCGGTTGTGAAA
CGGTAAAAAAAATCGGCGAGGTGATTAAAAACCCGGATATTCAGGTCGGTAAGCTGGCAGACCAGTCTTC
GCAGGTGACGATTACGCTGCTGACGGAGCCGGATGCCAATATCAACGCGGACGGTGAAGCGGCTGCGGTG
GACGTGCAGCTGGTTTATCTGAGCGATGACTCAAAATTTCAGGCGGCCGACTACGACCAGATAGCCACCA
CCGCACTACCCGACGCGCTGGGGAAAAACTATATCGATCACCAGGATTTCAGCCTGCTGCCCGACACCAT
GAAAACCCTGCCGCCGGTGAAGCTGGATGAGAAAACGCAGTTTATCGGCGTGATTGCCTATTTTTCCGAC
GACCAGACTACGGAATGGAAGCAAATCGAACCGGTAGAAGGGACAGGACACAACTACCGCCTGCTGGTGC
ATATCCGGCAGAGCAGTATTGAAATGAAAAAAGAGGATGATTAA
 Primer design