SecReT6
Protein ID: 205352296
SecReT6 ID303
T6SS typei1
Gene symbol-
Locus tagSG1038
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]1127323..1128621 [-]
Producthypothetical protein
NoteFha
UniProt IDB5R7B8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 432 a.a.     [Download]
>gi|205352296|ref|YP_002226097.1| hypothetical protein SG1038 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MEQNMAEEKARQQTLSLHVVNGNELESGRTARCLFTGDGDVGHGSECHWPVQDRHQNVPAKAFSISLHDG
AFCLHPLASPLWLNQAKVTAASDQVQLRQGDEIQTGHLILRVYLNQGGMRHYDEEMATPETIVSNHDLLS
DTLLSTDGAPEYPGMPSRHQLADTVVNGFSTDPLQVLQAESLTTRDNPLAGITPARPSAPLSDPAINGGI
NTPFMDLPSMYADPHDNEEGMSPADAAQRHLAVTPLLRGLGGSLAVHNTQDADDFLEEAGRTLQAAIQGL
LELQQRRNSLSDKHLRPLEDNPLRLNMDYATALDVLFAEGKSPVHLAAPAAVSESLRNIRHHEEANRAAI
VESLRVLLDAFSPQSLMRRFVQYRRSHELRKPLDDAGAWQMYCDYYDELASSRQQGFEMLFNEVYAQVYD
RVLREKQREPEA
 
Nucleotide Sequence: 1299 bp     [Download]
>gi|205351346|ref|NC_011274.1|:c1128621-1127323 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
ATGGAGCAGAATATGGCGGAAGAAAAAGCGCGGCAACAGACGCTTTCACTGCATGTCGTTAACGGTAACG
AGCTGGAGAGCGGACGTACCGCACGGTGTCTGTTCACCGGAGACGGCGATGTGGGCCACGGCAGCGAATG
CCACTGGCCTGTTCAGGACCGGCACCAGAACGTTCCGGCGAAGGCGTTCAGCATCAGCCTGCATGATGGC
GCATTCTGCCTGCATCCGCTGGCATCGCCATTATGGCTGAACCAGGCTAAAGTCACGGCGGCCTCAGACC
AGGTGCAGTTACGTCAGGGCGATGAGATCCAGACCGGGCATCTGATACTCCGGGTTTATCTGAACCAGGG
CGGGATGCGGCATTACGATGAGGAGATGGCGACGCCTGAAACCATCGTTTCTAACCACGACCTCCTGTCG
GACACGCTACTGTCCACGGACGGCGCGCCGGAATATCCGGGAATGCCGTCCCGCCATCAGCTCGCGGATA
CCGTTGTTAATGGCTTTTCCACCGATCCGTTGCAGGTGCTCCAGGCTGAAAGTCTGACCACCAGGGACAA
TCCGCTTGCGGGTATCACCCCGGCCCGGCCCTCCGCCCCGTTATCCGATCCGGCGATAAACGGCGGGATC
AACACGCCGTTTATGGATCTGCCGTCCATGTATGCCGATCCGCATGATAATGAAGAGGGCATGTCACCGG
CAGACGCGGCGCAGCGCCACCTCGCCGTCACGCCGTTACTGCGCGGGCTGGGGGGATCGCTTGCCGTGCA
TAACACCCAGGACGCCGATGATTTTCTGGAGGAGGCCGGAAGGACATTGCAGGCGGCGATTCAGGGGTTG
CTTGAGCTACAGCAGCGCCGCAACAGCCTGTCAGACAAGCATCTGCGCCCGCTGGAAGATAACCCGCTGC
GCCTGAATATGGACTACGCCACGGCGCTGGACGTGCTGTTTGCCGAAGGGAAAAGCCCGGTACATCTGGC
CGCGCCCGCCGCCGTCAGCGAGAGCCTGCGCAATATTCGTCATCACGAAGAAGCCAACCGCGCCGCGATT
GTGGAATCGCTGCGCGTGCTGCTGGACGCCTTCTCGCCACAGAGTCTGATGCGCCGTTTTGTGCAGTACC
GCCGCAGCCACGAACTGCGTAAACCGCTGGATGATGCCGGTGCGTGGCAGATGTACTGCGATTATTACGA
TGAGCTGGCCTCCAGCCGCCAGCAGGGTTTTGAGATGCTGTTTAACGAAGTGTATGCCCAGGTGTATGAC
CGGGTGTTGCGTGAAAAGCAGCGGGAGCCGGAAGCATGA
 Primer design