SecReT6
Protein ID: 205352297
SecReT6 ID303
T6SS typei1
Gene symbol-
Locus tagSG1039
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]1128634..1129728 [-]
Producthypothetical protein
NoteTssG
UniProt IDB5R7B9
KEGG IDseg:SG1039
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-88, Aligned region: 36..351
Protein Sequence: 364 a.a.     [Download]
>gi|205352297|ref|YP_002226098.1| hypothetical protein SG1039 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MEMGGKNRATPAHLSPDDAPAQDEQRTLREPLFQDACACNFFALSELLHRLASEGGETPVLSLDTPPAQE
TIRFQADASLGFPVSDVSALEQDASGLFRMTTTFMGLQGSQSPLPGYYLDHLAWKSAHEQSPVSDFLDMF
SHRLTQFVWHIWRKYRYHVAFRNGGVDAFSQRMYSLVGLGHRQLRDSLPVNHSKMLAYAGILANPGRSPE
IVCTLVAHCFDLNLSDVTLQNWQRRMVDIEPDQQNSLGCYTIKNGEKLAGRSVLGNFVLGTRVPDLSGKF
QLSINHLSRKQFLSFLPSGENFLPLAMFVSFVLRDQLAWDLHLGLAPDQVGIMRLGDNKSALLGWTSFLG
EPGEHPSVTIRVRE
 
Nucleotide Sequence: 1095 bp     [Download]
>gi|205351346|ref|NC_011274.1|:c1129728-1128634 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
ATGGAAATGGGCGGAAAGAACCGGGCAACACCCGCTCATCTGAGTCCGGACGATGCTCCGGCGCAGGATG
AACAACGCACGCTGCGGGAGCCGTTGTTTCAGGACGCCTGCGCCTGCAATTTTTTCGCGCTCTCTGAGCT
GCTGCACCGGCTGGCATCAGAAGGCGGCGAAACGCCAGTGTTATCCCTGGATACCCCTCCGGCGCAGGAA
ACCATTCGTTTCCAGGCGGACGCCAGCCTGGGATTTCCGGTAAGCGATGTCAGCGCGCTGGAGCAGGATG
CTTCCGGGTTGTTCCGGATGACCACCACCTTTATGGGATTGCAGGGCAGCCAGTCGCCCCTCCCCGGCTA
TTACCTTGATCACCTGGCCTGGAAATCCGCGCACGAGCAGAGTCCGGTCAGCGATTTTCTGGATATGTTC
AGCCATCGCCTGACGCAGTTTGTCTGGCATATCTGGCGTAAGTACCGTTACCACGTCGCTTTCCGTAACG
GCGGCGTGGATGCGTTCTCGCAGCGGATGTACTCCCTGGTGGGGCTGGGCCACCGGCAGCTTCGCGACAG
TCTGCCCGTTAACCACAGCAAAATGCTGGCCTATGCCGGGATACTGGCAAATCCGGGACGTTCGCCGGAG
ATCGTCTGTACGCTGGTTGCGCACTGTTTCGATTTAAATTTATCGGACGTGACGCTGCAAAACTGGCAGC
GGCGGATGGTGGATATCGAGCCGGATCAGCAGAACAGTCTTGGATGTTACACGATTAAAAATGGCGAAAA
ACTGGCCGGGCGATCGGTGCTGGGTAATTTTGTCCTCGGTACGCGGGTTCCCGATCTCAGCGGTAAATTT
CAGTTAAGTATTAACCACCTGAGCCGCAAGCAGTTTCTCTCGTTCCTGCCGTCAGGAGAAAATTTTCTGC
CGCTGGCGATGTTTGTCTCCTTCGTCCTGCGCGATCAGCTTGCCTGGGATTTACACCTGGGGCTGGCCCC
GGATCAGGTGGGGATTATGCGGCTGGGCGATAACAAGAGCGCGCTGCTGGGCTGGACGTCATTTCTCGGC
GAGCCGGGAGAGCATCCCTCAGTCACCATCAGGGTCAGGGAGTAA
 Primer design