SecReT6
Protein ID: 205352298
SecReT6 ID303
T6SS typei1
Gene symbol-
Locus tagSG1040
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]1129686..1131599 [-]
Producthypothetical protein
NoteTssF
UniProt IDB5R7C0
KEGG IDseg:SG1040
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.50E-191, Aligned region: 25..637
Protein Sequence: 637 a.a.     [Download]
>gi|205352298|ref|YP_002226099.1| hypothetical protein SG1040 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MCWSLIWHRTVVSIIGWSSRMEFEERYYRQELDHLRQLSKLLATEKPHLARFLAEKEADPDIERLLEGVA
FLTGNLRQKIEDEFPELTHGLIRMLWPNYLRPVPSMTLIEYTPDMDKTSVPVLIPRNEQFTTGAKGTQGS
PVLSAYSGNEHDVAPPCTFTLCRDIWLLPVQLDQVENRSTPRHGIIDITFAVAPGTDFATLDLNRLRFWL
GNDDNYTRYQLYLWFCEYLQGAELMAGGQSIPMPEFMLKAVGFESEDAMLPWPGNVHSGYRILQEFFCYA
DSFLFFDACGIPALPDRLKENRFTLRLRFSRPLPADIRLRDDSLRLYCAPAINLFAHHAEAITLDHQRQD
YALVPSRHFPDHYDIFSVNSVVSQTQGKQRKADLGRPVITEAARHWPAFESFRHQMEYSRKREVVYWQHR
TRTSLFHRGFDHTLAFIHADGSLPDASLLNNEVVSVSLTCTNRELPVQLRPGDITGTTGKNASVASFRNI
TRPTRPLWPVIDGSLHWSLLSAMNLNYLSLLDADALKQVIANFDRHAIHHPQMARLSQQKLDAIERLETT
PVDRLFTGIPVRGLASTLSIHPEPFVCEGEMYLLGAVLSHFLSLYAIVNSFHMLTVVNTESQESWKWAER
TGQHPLI
 
Nucleotide Sequence: 1914 bp     [Download]
>gi|205351346|ref|NC_011274.1|:c1131599-1129686 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
ATGTGCTGGAGTTTGATATGGCACCGGACGGTAGTCAGCATTATCGGGTGGAGTAGCAGAATGGAATTCG
AAGAACGCTATTACAGGCAGGAGTTGGATCACCTGCGGCAGTTGAGCAAGCTGCTGGCGACCGAAAAGCC
GCATCTGGCCCGGTTTCTGGCAGAAAAAGAGGCCGATCCGGATATCGAGCGTCTGCTGGAGGGCGTGGCC
TTTCTGACCGGCAATCTGCGCCAGAAAATCGAGGATGAGTTTCCGGAGCTGACGCACGGACTGATCCGGA
TGCTGTGGCCCAATTATCTGCGCCCGGTGCCGTCGATGACGCTGATTGAATATACGCCGGATATGGATAA
AACTTCCGTGCCGGTACTGATCCCCCGTAATGAGCAGTTCACAACCGGGGCGAAGGGGACTCAGGGAAGC
CCGGTATTGTCTGCGTATTCCGGCAATGAGCACGATGTAGCCCCGCCCTGTACGTTCACCCTGTGCCGGG
ATATCTGGCTGTTACCCGTTCAACTGGATCAGGTTGAAAATCGCAGTACGCCCCGCCACGGCATTATTGA
TATTACGTTTGCCGTCGCACCGGGCACTGATTTTGCCACGCTGGATCTGAACAGGCTGCGCTTCTGGCTG
GGCAACGATGATAACTATACCCGCTATCAGCTTTATCTGTGGTTTTGTGAATATTTACAGGGCGCAGAGT
TGATGGCGGGCGGGCAGTCGATCCCGATGCCTGAATTTATGCTGAAAGCGGTGGGTTTTGAGTCAGAGGA
CGCCATGCTGCCCTGGCCCGGCAATGTCCACAGCGGCTACCGCATTCTCCAGGAGTTTTTCTGCTACGCC
GACAGTTTTCTGTTTTTCGATGCCTGTGGCATTCCGGCATTGCCAGACAGGTTAAAGGAGAACCGTTTCA
CTCTGCGGCTGCGGTTTTCTCGCCCCTTACCGGCAGATATCCGGCTGCGGGATGATTCCCTGCGCTTATA
TTGTGCGCCCGCCATTAATCTGTTTGCCCACCATGCCGAAGCCATCACGCTGGATCATCAGCGGCAGGAT
TACGCTCTGGTTCCCAGCCGTCATTTTCCGGATCATTACGACATTTTTTCGGTTAACAGCGTGGTGAGTC
AGACGCAGGGGAAGCAGAGAAAAGCGGATCTTGGACGGCCGGTGATCACAGAGGCCGCGCGCCACTGGCC
TGCTTTTGAGAGTTTCCGCCACCAGATGGAGTACAGCCGTAAGCGGGAAGTGGTCTACTGGCAGCACCGG
ACCAGGACCTCGCTGTTTCACCGGGGCTTTGATCATACCCTGGCTTTTATTCATGCCGATGGCAGCCTCC
CGGATGCCTCACTGCTTAATAATGAAGTGGTTTCTGTATCGCTGACCTGCACCAACCGGGAGCTGCCGGT
ACAGCTACGGCCCGGCGATATCACCGGTACGACAGGTAAAAACGCGTCGGTGGCGTCATTTCGCAATATC
ACCCGCCCCACCAGACCGCTCTGGCCGGTGATTGACGGCAGCCTGCACTGGTCGTTGCTGTCTGCCATGA
ACCTGAATTATCTGTCGTTGCTGGATGCTGATGCGCTCAAACAGGTGATCGCCAATTTTGATCGCCACGC
CATCCATCATCCGCAGATGGCCCGTCTGTCACAGCAGAAGCTGGACGCCATTGAACGGCTGGAAACAACC
CCGGTTGATCGCCTGTTTACCGGCATACCGGTGCGCGGGCTGGCGTCCACCCTGTCCATTCATCCGGAGC
CGTTTGTCTGCGAGGGTGAAATGTACCTGCTGGGCGCGGTGCTGTCGCATTTTCTGTCGCTGTACGCCAT
CGTCAATTCGTTCCACATGCTGACCGTCGTTAACACGGAAAGCCAGGAGTCATGGAAATGGGCGGAAAGA
ACCGGGCAACACCCGCTCATCTGA
 Primer design