SecReT6
Protein ID: 205352300
SecReT6 ID303
T6SS typei1
Gene symbol-
Locus tagSG1042
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]1133720..1134232 [-]
Producthypothetical protein
NoteTssB
UniProt IDB5R7C2
KEGG IDseg:SG1042
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.50E-54, Aligned region: 10..166
Protein Sequence: 170 a.a.     [Download]
>gi|205352300|ref|YP_002226101.1| hypothetical protein SG1042 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MISMSKDYNGSVAPKERINISYIPKTDGEPSEVELPLNMLIVGDTGNSQETAPLDERQMVSIDKHSFNSV
MAEASISLNFAVPASLKDDAKDGDEMNISLEIKSLNDFSPDSVAKQVPELNKLLELREALTALKGPLGNL
PAFRAQLQALLENEESREQLLREISQAENQ
 
Nucleotide Sequence: 513 bp     [Download]
>gi|205351346|ref|NC_011274.1|:c1134232-1133720 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
ATGATCTCTATGAGCAAAGATTATAACGGCAGCGTGGCACCCAAAGAACGCATTAATATTTCTTACATTC
CAAAAACGGACGGTGAGCCTTCTGAGGTGGAATTACCCCTTAATATGTTGATAGTGGGGGATACCGGAAA
CTCACAGGAAACAGCGCCACTTGATGAACGCCAGATGGTTTCTATCGACAAACATTCATTCAATTCAGTG
ATGGCAGAAGCGTCCATTAGCCTGAATTTTGCAGTTCCGGCATCATTGAAGGACGACGCAAAAGATGGCG
ATGAGATGAATATCTCGCTGGAAATCAAATCCCTGAACGATTTTTCTCCGGACAGCGTGGCAAAACAGGT
ACCGGAGTTGAACAAATTGCTGGAACTACGCGAAGCGCTGACAGCATTAAAAGGCCCGCTCGGTAATCTG
CCTGCATTTCGCGCCCAGCTTCAGGCATTGCTGGAAAATGAAGAATCCCGCGAACAGTTACTGCGGGAGA
TCAGCCAGGCAGAAAACCAGTAA
 Primer design