SecReT6
Protein ID: 205352302
SecReT6 ID303
T6SS typei1
Gene symbol-
Locus tagSG1044
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]1135593..1137704 [+]
ProductRHS family protein
NoteTssI
UniProt IDB5R7C4
KEGG IDseg:SG1044
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.30E-65, Aligned region: 28..328
Phage_base_V [PF04717], Evalue: 4.50E-25, Aligned region: 365..457
Gp5_C [PF06715], Evalue: 0.0067, Aligned region: 499..521
Gp5_C [PF06715], Evalue: 0.0067, Aligned region: 523..545
Gp5_C [PF06715], Evalue: 0.0067, Aligned region: 539..561
Gp5_C [PF06715], Evalue: 0.0067, Aligned region: 574..578
Gp5_C [PF06715], Evalue: 0.0067, Aligned region: 608..623
Protein Sequence: 703 a.a.     [Download]
>gi|205352302|ref|YP_002226103.1| RHS family protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MSTGLRFTLEVDGLPPDALVVESFHLSQSLSTLFSLDISLVSQQLHNIEFAQVLEKPAHLKIWQGTEIQR
RVNGIVTWFEQGENDGHQMLYSMKVRPPVWRAALRQNSRIFQNEDIKSILGTILQENGVTDWSPLFSEAH
PAREFCVQYSETDYDFLARMAAEEGIFFYEEHAQTSDDQSLVLCDTVRFLPEAFEIPWNPNTRTEVSTPC
VSQFRHSAQIRPSSVIGKDYTFKRPGWAGRFEHQGEHQDYQRTQYEVFDYPGRFKDGHGQNFARWQMEGW
RNNAEVAQGKSRSPAIWPGRRIQLTEHPQASLNREWQVVSSDLHGSQPQAAGRSGSGTTLDNHFTVIPAD
RTWRPRPLPKPSVDGPQSAVVTGPEGEEIFCDEHGRVRVKFNWDRYNPANQDSSCWIRVVQAWAGPGFGN
LAIPRVGQEVIVDFLNGDPDQPSIMGHTYHQENRSPGSLPGTKTQMTIRSKTYKGSGFNELMFDDATGKE
RVYIHAQKNMNTEVLHNRTTDVTNNHAETIGNNQVIAVTNNQIQTIGVNQVEKVGSNQVIKVGANQVETV
GIVRALNVGLAYQTTVGGIMNTSVALMQSSEVGIFKSLNVGVKYNVNVGRNASVNVGNSKTESTGKTAVY
SAGEHLELVCGEARLVLTSDGGIFLNGKHIELQGVDSLNGDSKLISWNCGVSKKPPEASEQQDDPDPSDL
IMY
 
Nucleotide Sequence: 2112 bp     [Download]
>gi|205351346|ref|NC_011274.1|:1135593-1137704 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
ATGTCAACAGGATTACGTTTCACACTGGAGGTGGACGGTCTGCCACCGGATGCGCTGGTCGTGGAGTCCT
TTCACCTGAGCCAGTCCCTTTCCACGTTATTTTCCCTCGATATCTCGCTGGTCAGTCAGCAACTTCACAA
CATTGAGTTTGCCCAGGTACTGGAAAAACCGGCGCACCTGAAAATCTGGCAGGGCACGGAGATACAGCGC
CGGGTGAACGGCATAGTGACCTGGTTTGAGCAGGGGGAAAACGACGGACACCAGATGCTGTACAGCATGA
AAGTTCGTCCGCCGGTGTGGCGCGCCGCGCTGCGCCAGAACTCGCGTATTTTCCAGAATGAAGACATAAA
AAGCATTCTCGGGACGATACTGCAGGAAAACGGCGTGACGGACTGGAGCCCGCTGTTCAGTGAGGCGCAT
CCGGCGCGGGAGTTCTGCGTGCAGTACAGCGAAACGGATTACGACTTTCTGGCGCGGATGGCGGCGGAGG
AAGGTATTTTCTTTTACGAGGAACATGCGCAGACCAGCGACGACCAGAGCCTGGTGCTGTGCGACACGGT
ACGTTTTCTGCCGGAAGCCTTTGAAATCCCCTGGAACCCGAACACCCGTACCGAGGTGAGCACGCCGTGC
GTCAGCCAGTTCCGCCACAGCGCGCAAATCCGCCCCTCTTCCGTCATCGGCAAGGACTACACCTTCAAAC
GCCCCGGCTGGGCGGGCCGCTTTGAGCACCAGGGCGAACATCAGGATTACCAGCGCACGCAGTATGAGGT
CTTTGATTATCCGGGGCGCTTCAAGGACGGCCACGGTCAGAACTTCGCCCGCTGGCAGATGGAAGGCTGG
CGTAATAATGCCGAAGTGGCGCAGGGGAAAAGCCGTTCGCCGGCGATATGGCCGGGACGGCGTATTCAGC
TGACGGAACACCCGCAGGCGAGCCTGAACCGGGAATGGCAGGTGGTGAGCAGCGATTTACACGGCAGCCA
GCCGCAGGCGGCGGGGCGCTCAGGTTCAGGGACAACGCTGGACAATCATTTTACGGTCATCCCGGCAGAC
AGAACATGGCGGCCACGCCCGCTGCCCAAACCATCAGTGGACGGCCCGCAGTCGGCGGTGGTCACCGGCC
CGGAAGGGGAAGAAATCTTCTGCGACGAACATGGCCGTGTACGGGTGAAATTTAACTGGGACCGGTATAA
CCCGGCGAACCAGGACAGCTCGTGCTGGATACGGGTGGTACAGGCGTGGGCGGGGCCGGGGTTCGGCAAC
CTGGCGATACCGCGCGTGGGGCAGGAAGTGATAGTGGACTTCCTCAACGGCGACCCGGACCAGCCCAGCA
TCATGGGGCACACCTACCACCAGGAAAACCGCTCACCGGGCAGCCTGCCGGGCACCAAAACGCAGATGAC
CATCCGCTCGAAAACCTATAAAGGCAGCGGGTTTAACGAACTCATGTTTGATGATGCGACAGGGAAGGAG
CGCGTGTATATCCACGCGCAGAAGAATATGAATACCGAGGTGCTGCACAACCGCACCACCGATGTGACGA
ATAATCATGCTGAAACCATTGGTAATAACCAGGTGATCGCCGTTACCAATAACCAAATCCAGACCATCGG
CGTCAACCAGGTGGAGAAGGTGGGCAGTAACCAGGTGATCAAGGTGGGTGCCAATCAGGTGGAAACGGTG
GGGATTGTCCGCGCCCTGAATGTGGGGCTGGCATACCAGACTACCGTGGGCGGCATCATGAATACCTCGG
TGGCGCTGATGCAGTCTTCTGAGGTCGGGATCTTCAAATCACTGAATGTGGGAGTGAAATACAACGTCAA
TGTCGGGCGTAATGCCAGCGTTAACGTGGGCAACAGTAAAACCGAAAGTACCGGTAAAACGGCGGTGTAT
TCCGCAGGCGAGCATCTGGAACTGGTGTGTGGTGAAGCCCGTCTGGTGCTGACGAGCGACGGCGGTATTT
TTCTGAACGGCAAACATATTGAGTTGCAGGGCGTGGACAGCTTAAACGGGGATTCAAAGCTGATCAGCTG
GAACTGTGGGGTGAGCAAGAAGCCACCTGAAGCATCTGAACAGCAGGATGACCCCGATCCATCGGATCTG
ATCATGTACTGA
 Primer design