SecReT6
Protein ID: 205352303
SecReT6 ID303
T6SS typei1
Gene symbol-
Locus tagSG1045
StrainSalmonella enterica subsp. enterica serovar Gallinarum str. 287/91
Repliconchromosome [GenBank: NC_011274] [Browse all T6SS(s) in this replicon]
Location [Strand]1137806..1141114 [+]
ProductRHS family protein
NotePAAR
UniProt IDB5R7C5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 213..244
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 233..246
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 332..368
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 360..391
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 432..456
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 441..478
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 465..499
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 505..530
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 551..583
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 590..626
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 632..667
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 673..703
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 694..725
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 714..744
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 735..773
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 827..840
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 877..906
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 945..965
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 956..998
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 986..1020
RHS_repeat [PF05593], Evalue: 3.50E-55, Aligned region: 1047..1062
Protein Sequence: 1102 a.a.     [Download]
>gi|205352303|ref|YP_002226104.1| RHS family protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91]
MIGKPAARQGDMTQVGGPIVQGSAGVLIGAPTGGACSVCPTGEASPKYGNPVNPLLGAKVLPGETDIALP
GPLPFVLSRAYSSYRTKTPAPVGLCGPGWKLPSDLWLQLRGDGLILNDNGGRSVHFEPLAPGDIQYSRRE
SFWLARGGAASQHNSHPLSVMWGMLPEAVRLCPHIYLATNSPQGPWWVLGWAERVPGADEALPAPLPPYR
VLTGVVDGYGRRLTYHRDGAYGGAVTAVTDSTGRRYRLVLTTQAQRAAQAASASSSSLSPAPSSFPSFSS
PPSPRSPSSWSETLPVTACGEDSGIRLSAVWLVEDPACPDALPSQPLVRYGYTARGELEAVYDRSGAEVR
RFEYDAGQPGRMTAHRYAGRPASRYRYDDAGRVTEQVNPEGLGYAFAYEKNKITVTDSLGRREVLHTEGE
GGLKRVVMKEQADGSVIRSGYDGSGRLEWRTDAAGRKTTYNPDVATGKLTAVTGPDGRKTKYSYNDRQQL
TATVHPDGRRSTREYDRQGRLVKTVLREGKVTEYAYGSAHDSQPSVVKDSSGSRRIRRGRNGEVVSRTDC
SGYETRYEYNRYGQQTAVHYEEGLSVYRGYDRRGRLSSVKDSQGRETTYEYSDAGDLTAVTRPDGQRREA
EYDARGRLISVTEGGLTRRVEYDAAGRVVRLENENGAEMRFTYDALNRVTEQRGFDGRTQRYGYDRSGRL
ARSEDEDLVTHWHYDNADRLTQRTVNGQEAERWQYDERGWLTALSHISEGQRVTVHYGYDNKGRLTSERQ
TVHNPETEEPLWAHSVRHGYNDRGQAVREAYDGLPVAEWLTYGSGHLEGLKLGSQPLVEYTRDRLHRETE
RQFGAWRMETGYTAGGEVAYRHLPEAALSREYRHDVPGFLTGIDGAGESWRYGYDGAGRLSAVGLTTREM
SVDIPYETDGAGNRVEAGAERREANGLPGVFADNRVTEDGRYVYRYDRYGNLVEKGERVPAGAIRSGDER
THHYRYDRHHRLVSYRCTEGYGSRSITESRYVYDATGRRVCKKVWRRERYATGRCHDYTALPETPEVTWY
GWSGDRLVTAQTERSRIQTVYEGGGFTPLVRVETATAALTTVRSRRSLAEKL
 
Nucleotide Sequence: 3309 bp     [Download]
>gi|205351346|ref|NC_011274.1|:1137806-1141114 Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91 chromosome, complete genome
ATGATCGGAAAACCAGCGGCGCGTCAGGGCGACATGACCCAGGTGGGCGGCCCGATAGTTCAGGGTTCAG
CGGGGGTACTGATAGGCGCACCGACGGGGGGGGCGTGCTCGGTGTGCCCAACCGGAGAGGCCAGTCCGAA
GTACGGCAATCCGGTGAACCCGCTGCTGGGGGCGAAGGTCCTGCCCGGCGAGACCGATATTGCGCTGCCC
GGCCCGCTGCCGTTCGTGCTTTCCCGCGCCTACAGCAGTTACCGGACGAAGACGCCCGCGCCGGTGGGGC
TGTGCGGGCCGGGCTGGAAGCTGCCGTCAGACCTGTGGTTACAGCTGCGCGGCGACGGGCTGATACTGAA
CGATAACGGGGGCAGGAGCGTGCATTTTGAGCCTCTGGCGCCGGGGGATATACAGTACAGCCGCAGAGAG
TCATTCTGGCTGGCGCGGGGCGGGGCGGCATCGCAGCACAACAGCCACCCGCTGTCGGTCATGTGGGGCA
TGCTGCCGGAGGCGGTGCGGCTGTGCCCGCATATTTACCTGGCGACGAACAGCCCGCAGGGGCCGTGGTG
GGTGCTGGGATGGGCTGAACGGGTGCCGGGGGCGGATGAGGCGCTGCCCGCGCCGCTGCCGCCGTACCGG
GTGCTGACGGGGGTGGTGGACGGTTATGGCCGCCGTCTGACGTACCATCGCGACGGTGCATACGGCGGCG
CGGTGACGGCGGTGACGGACAGCACCGGGCGGCGCTACCGGCTGGTGCTGACCACGCAGGCGCAGCGCGC
GGCGCAGGCGGCGTCAGCGTCTTCTTCGTCATTATCTCCCGCCCCGTCGTCGTTCCCTTCATTTTCTTCC
CCACCCTCTCCCCGCTCACCGTCCTCCTGGTCGGAGACGCTGCCTGTAACCGCCTGCGGTGAGGACAGCG
GCATCAGGCTGTCGGCGGTGTGGCTGGTGGAAGACCCGGCCTGTCCGGATGCGCTGCCGTCGCAGCCGCT
GGTGCGTTACGGGTACACGGCGCGCGGTGAGCTGGAGGCGGTGTATGACCGCAGCGGTGCGGAGGTAAGG
CGCTTTGAGTATGACGCCGGGCAGCCGGGGAGGATGACGGCGCACCGTTACGCGGGAAGACCGGCGAGCC
GCTACCGGTATGATGACGCGGGGCGGGTGACGGAGCAGGTCAACCCGGAAGGGCTGGGTTATGCGTTCGC
GTATGAGAAGAACAAAATAACGGTAACGGACAGCCTGGGGCGGCGTGAAGTGCTGCACACGGAAGGCGAG
GGTGGCCTGAAACGGGTGGTGATGAAGGAGCAGGCGGACGGGAGCGTTATCCGCAGCGGGTATGACGGTT
CAGGGCGGCTGGAATGGAGGACGGACGCGGCGGGGAGAAAGACGACATACAACCCGGACGTGGCGACAGG
GAAGCTGACGGCGGTGACGGGGCCGGACGGGAGGAAGACGAAGTACAGTTATAACGACCGGCAGCAGCTG
ACAGCCACCGTCCACCCGGACGGACGGCGCAGCACGCGGGAGTATGACCGTCAGGGCCGTCTGGTGAAAA
CGGTGTTGCGTGAGGGGAAGGTCACAGAGTATGCGTATGGCAGCGCCCATGACAGCCAGCCGTCGGTGGT
GAAGGACAGCTCCGGCAGCCGCCGGATAAGGCGGGGACGTAACGGGGAGGTGGTGTCGCGGACGGACTGC
TCGGGTTATGAGACGCGGTATGAGTATAACCGCTACGGGCAGCAGACGGCGGTGCATTATGAGGAAGGCC
TCAGCGTTTACCGGGGTTACGACCGCCGGGGCAGGCTGTCGTCAGTGAAGGACAGCCAGGGTCGTGAGAC
GACATACGAATACAGCGACGCGGGCGACCTGACGGCGGTGACCCGCCCGGACGGCCAGCGGCGGGAGGCG
GAGTATGACGCGCGCGGGCGGCTCATCAGCGTGACGGAAGGGGGGCTGACGCGGCGGGTGGAGTACGATG
CGGCAGGGCGCGTGGTGCGGCTGGAAAACGAGAACGGCGCGGAGATGCGCTTCACGTATGATGCGCTGAA
CCGGGTAACGGAACAGCGGGGCTTTGACGGCAGGACGCAGCGGTATGGCTATGACCGGAGCGGACGGCTG
GCGCGCAGTGAGGACGAGGACCTTGTCACGCACTGGCACTACGATAACGCCGACCGGTTAACGCAGCGCA
CCGTCAACGGTCAGGAAGCGGAACGGTGGCAGTATGACGAACGCGGGTGGCTGACGGCGCTGAGCCATAT
CAGCGAAGGGCAGCGTGTGACGGTGCATTACGGCTACGATAATAAAGGCCGTCTCACCAGCGAGCGGCAG
ACGGTCCATAACCCGGAGACGGAAGAACCGCTGTGGGCGCACAGCGTGCGGCACGGTTATAACGACCGGG
GGCAGGCGGTACGGGAAGCGTATGACGGCCTGCCGGTGGCGGAGTGGCTGACGTACGGCAGCGGGCACCT
GGAGGGGCTGAAACTGGGAAGCCAGCCGCTGGTGGAGTACACGCGCGACAGGCTGCACCGTGAGACGGAG
CGGCAGTTCGGTGCGTGGCGGATGGAGACGGGCTACACGGCGGGGGGTGAGGTGGCATACCGGCACCTGC
CGGAGGCGGCGCTGAGCCGGGAATACCGGCATGACGTACCGGGGTTCCTGACGGGCATCGACGGCGCGGG
TGAAAGCTGGCGTTACGGTTATGACGGGGCGGGAAGGCTGTCGGCGGTGGGCCTGACGACCAGAGAAATG
AGCGTGGACATCCCGTATGAGACGGACGGAGCGGGAAACCGGGTGGAAGCGGGGGCGGAACGCCGGGAGG
CGAACGGACTGCCGGGCGTCTTCGCGGACAACCGGGTAACGGAGGACGGGCGGTACGTGTACCGTTACGA
CCGGTACGGCAACCTGGTGGAGAAGGGAGAGCGCGTCCCGGCGGGCGCGATACGCAGCGGCGATGAGCGG
ACGCACCATTACCGTTATGACCGTCATCACCGGCTGGTGAGCTACCGGTGTACGGAGGGTTACGGAAGCC
GGAGCATCACGGAGAGCCGGTACGTATACGATGCGACCGGCCGGCGGGTGTGTAAAAAGGTATGGCGGCG
TGAGCGGTATGCGACAGGACGCTGTCATGACTACACGGCGCTGCCGGAGACCCCGGAAGTGACGTGGTAC
GGGTGGAGCGGGGACAGGCTGGTGACGGCGCAGACGGAACGGAGCCGCATCCAGACGGTGTACGAGGGAG
GCGGGTTCACGCCGCTGGTCAGGGTGGAGACGGCGACAGCGGCCCTGACAACGGTCCGTAGCCGGAGGAG
CCTGGCGGAGAAGCTCTAG
 Primer design