SecReT6
Protein ID: 206558757
SecReT6 ID292
T6SS typei4b
Gene symbol-
Locus tagBCAL0351
StrainBurkholderia cenocepacia J2315
Repliconchromosome I [GenBank: NC_011000] [Browse all T6SS(s) in this replicon]
Location [Strand]378936..382880 [-]
Productputative type VI secretion system protein TssM
NoteTssM
UniProt IDB4E6S3
KEGG IDbcj:BCAL0351
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.80E-71, Aligned region: 193..451
IcmF-related [PF06761], Evalue: 4.90E-52, Aligned region: 498..569
IcmF-related [PF06761], Evalue: 4.90E-52, Aligned region: 630..877
DUF1215 [PF06744], Evalue: 1.70E-29, Aligned region: 1010..1125
Protein Sequence: 1314 a.a.     [Download]
>gi|206558757|ref|YP_002229517.1| putative type VI secretion system protein TssM [Burkholderia cenocepacia J2315]
MQRILNVLTHPRTLSIVGIVALAAILFIVADMLQLPLLWAATAFAAILALWLVVALWRRWRVKRANQQLG
QVLEEQAETGKIAAPAAAALAPDAKTADLDVLRTRLSDAVKTIKTSKIGQVSGGSALYELPWYIVIGNPA
AGKSSAVLNSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLGLLKRY
RPKAPINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSS
DKHEYDRVWGATLPYEPDDKRDVVAQFDTHFEELYEGLKEISVAQLSLSRGNQLSPGQLSFPLEFSTIKP
SLRAFLATLFENNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAHRFGLDGNALPKPHSAFSKNGFFLRD
LFSKVIFADRQTVRQFASPTKTRLRYATFFGFVAALALALGGWTWSTIGNQQLVANVQADLDNVTRLQQG
RNDLQSRLQAMDILEDRIEQLEQFRRDKPMSVSLGLYQGDRLEQHLLTEYYNGVRQILLAPVSQNLASFM
KDVNAHPEQLVPMTRPPESGAVPGGTIPVSTNAAGAAPQAGAALAASGTAPATAPQQAAAPQGGLYSDAS
PTNVQDAYNALKTYLMLSDKRHVEQAHLTDQLARFWRGWLETNRGNMPRDEMIRSAERMISFYLSRVNDN
DWPMIDANLALVDQTRENLRRVVRGMPARQRVYEEIKARASTRFAPMTIARIVGDGNQGLVAGSYAIPGT
FTREAWFDYVQPAIRDAATKELQAKDWVLNTSTQDDLTLEGSPEQIQKTLVGMYKTEYAQHWQKFMQGIA
VQGFTSFGQAVDGMNRLGDPQDSPIRKILETAYDQTSWDNPSLANVTIKKAQTGVVNWVKQLFSRSQAGQ
VAAANIDINGNPAEVPMGPIGQEFVGLARIVATHDGTSMLKGYMESLSKVRTRFNVIKNQGDPGPGARQL
MQQTLDGSGSELADSLKLVDEQMLTGLTDSQRKSLRPLLVRPLMQAFAVVIQPASAEVNKVWNAQVYQPF
QSSLATKYPFAANAKVEAGAGEIAQVFGPDGSIAKFVGTTLGPLAVRRGDTLAARTWGDMGIGLTPDFTN
GFARWVAPLAGGAAGSAAASAEPQTVFQILPQPSTGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPQGSP
GATLSATTFDGRTVQLVNEPGRYGLEKLINSAQRKRRPDGTFDLTWAQGSVNVSVTMRIISTSQPSAGGG
DQPQQQSLRGLQLPSSVADASAGAAQNATQAGTGTPGAAPAVAAANATNAQRAQ
 
Nucleotide Sequence: 3945 bp     [Download]
>gi|206558403|ref|NC_011000.1|:c382880-378936 Burkholderia cenocepacia J2315 chromosome 1, complete sequence
ATGCAACGCATCCTCAACGTGCTGACTCATCCGCGTACGCTCTCGATCGTCGGGATCGTCGCGCTAGCGG
CCATTCTGTTCATCGTCGCCGACATGTTGCAGCTGCCGCTCCTGTGGGCGGCGACCGCGTTCGCGGCGAT
CCTCGCGCTGTGGCTCGTGGTCGCGCTGTGGCGCCGCTGGCGCGTGAAGCGTGCGAACCAGCAGCTCGGC
CAGGTGCTGGAAGAGCAGGCGGAAACCGGCAAAATCGCCGCGCCGGCCGCTGCCGCGCTCGCACCGGACG
CGAAGACGGCCGACCTCGACGTGCTGCGCACGCGCCTGTCGGATGCGGTGAAGACGATCAAGACGTCGAA
GATCGGCCAGGTGTCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAACCCGGCC
GCGGGCAAGAGCAGCGCCGTGCTCAATTCCGGCCTGCAGTTCCCGTTCGCGGACAAGAACAGCGCCGTGA
TCCACGGCATCGGCGGCACGCGTAACTGCGACTGGTTCTTCACGACCGAAGGGATCCTGCTCGACACGGC
CGGCCGCTATTCGGTGCACGAGGAAGACCGCAGCGAATGGCTCGGCTTCCTCGGGCTGCTCAAGCGCTAC
CGTCCGAAGGCGCCGATCAACGGCATCATCGTCACGGCCAGCATCGCCGAACTCACCGGCAATCGCCCCG
AATTCGCGATCAACCTCGCGAAGAACCTCCGTCAGCGCGTTCAGGAGCTGACGGAAAAGCTGGAAGTGTT
CGCGCCGGTCTACGTGATGTTCACGAAGGCCGACCTGATCACCGGCTTCACCGAATTCTTCAGCAGCAGC
GACAAGCACGAGTACGACCGCGTGTGGGGCGCCACCCTGCCCTACGAGCCCGACGACAAGCGCGACGTCG
TCGCGCAGTTCGACACGCACTTCGAGGAACTCTACGAAGGGCTGAAGGAAATCAGCGTCGCGCAGCTGTC
GCTGTCGCGCGGCAACCAGCTGTCGCCGGGCCAGTTGAGCTTCCCGCTCGAATTCTCGACGATCAAGCCG
TCGCTGCGCGCGTTCCTCGCGACGCTGTTCGAGAACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCT
TCTACTTCACCAGCGCGCTGCAGGAAGGCGAAACCAACAGCGCGGCCGCGCAGCGCATCGCGCACCGCTT
CGGCCTCGACGGGAATGCGCTGCCGAAACCGCACAGCGCGTTCTCGAAGAACGGCTTCTTCCTGCGCGAC
CTGTTCTCGAAGGTGATCTTCGCGGACCGCCAGACGGTGCGCCAGTTCGCGAGCCCGACCAAGACGCGGC
TGCGCTACGCGACCTTCTTCGGCTTCGTCGCGGCGCTCGCGCTCGCGCTGGGCGGCTGGACCTGGTCGAC
GATCGGCAACCAGCAGCTGGTCGCGAACGTGCAGGCCGACCTCGACAACGTCACGCGCCTGCAGCAGGGC
CGCAACGACCTGCAGTCGCGCCTGCAGGCGATGGACATCCTCGAGGACCGGATCGAGCAGCTCGAACAGT
TCCGCCGCGACAAGCCGATGTCGGTGTCGCTCGGCCTGTACCAGGGCGACCGGCTCGAGCAGCATCTGCT
GACCGAGTACTACAACGGCGTGCGCCAGATCCTGCTCGCGCCGGTCTCGCAAAACCTCGCGTCGTTCATG
AAAGACGTGAACGCGCACCCCGAGCAGCTCGTGCCGATGACGCGCCCGCCCGAATCGGGCGCCGTGCCGG
GCGGCACGATACCGGTCTCGACGAACGCGGCAGGCGCCGCCCCGCAGGCGGGCGCCGCGCTGGCCGCGTC
CGGCACCGCGCCGGCCACCGCGCCGCAACAGGCGGCGGCCCCGCAAGGCGGCCTCTACAGCGACGCGTCG
CCAACCAACGTGCAGGATGCGTACAACGCGCTCAAGACGTACCTGATGCTGTCCGACAAGCGTCACGTCG
AACAGGCGCACCTGACCGATCAACTCGCCCGCTTCTGGCGCGGCTGGCTCGAGACGAATCGCGGCAACAT
GCCGCGCGACGAGATGATCCGGAGCGCCGAGCGGATGATCTCGTTCTACCTGTCCCGCGTGAACGACAAC
GACTGGCCGATGATCGACGCGAACCTCGCGCTCGTCGACCAGACCCGCGAGAACCTGCGCCGCGTGGTGC
GCGGCATGCCGGCCCGCCAGCGCGTCTACGAGGAAATCAAGGCCCGCGCGTCGACCCGCTTCGCGCCGAT
GACCATCGCGCGCATCGTCGGCGACGGCAACCAGGGGCTCGTGGCAGGCAGCTACGCGATTCCGGGCACG
TTCACGCGTGAAGCGTGGTTCGACTACGTGCAGCCGGCGATCCGCGATGCGGCGACCAAGGAGCTGCAGG
CGAAGGACTGGGTGCTCAACACGTCGACGCAGGACGACCTGACGCTCGAGGGCAGCCCCGAGCAGATCCA
GAAGACGCTCGTCGGCATGTACAAGACCGAGTACGCGCAGCACTGGCAGAAGTTCATGCAGGGCATCGCG
GTACAGGGCTTCACCAGCTTCGGCCAGGCCGTCGACGGGATGAACCGCCTCGGCGACCCGCAGGATTCGC
CGATCCGCAAGATCCTCGAGACCGCGTACGACCAGACGTCGTGGGACAACCCGTCGCTCGCGAACGTGAC
AATCAAGAAGGCGCAGACGGGCGTCGTGAACTGGGTCAAGCAGCTGTTCTCGCGCTCGCAGGCCGGCCAG
GTGGCGGCAGCCAACATCGACATCAACGGCAATCCGGCCGAGGTGCCGATGGGTCCGATCGGCCAGGAGT
TCGTCGGGCTCGCGCGGATCGTCGCGACGCACGACGGCACGTCGATGCTGAAGGGCTACATGGAGTCGCT
GTCGAAGGTCCGCACGCGCTTCAACGTGATCAAGAACCAGGGCGACCCGGGGCCGGGCGCGCGCCAGCTG
ATGCAGCAGACGCTCGACGGCAGCGGTTCGGAACTTGCCGATTCGCTGAAGCTCGTCGACGAGCAGATGC
TGACGGGCCTGACCGATTCGCAACGCAAGTCGCTGCGTCCGCTGCTGGTGCGGCCGCTGATGCAGGCGTT
CGCGGTCGTGATCCAGCCGGCCAGCGCCGAAGTCAACAAGGTGTGGAACGCGCAGGTCTACCAGCCGTTC
CAGAGCTCGCTCGCGACGAAGTACCCGTTCGCCGCGAACGCGAAGGTCGAGGCCGGCGCCGGCGAGATCG
CGCAGGTGTTCGGTCCGGACGGCTCGATCGCGAAGTTCGTCGGGACGACGCTCGGGCCGCTCGCGGTGCG
CCGCGGCGACACGCTCGCCGCCCGCACGTGGGGCGACATGGGCATCGGACTCACGCCGGACTTCACCAAC
GGCTTCGCCCGCTGGGTCGCGCCGCTCGCGGGCGGCGCGGCCGGCAGCGCAGCCGCGTCGGCCGAGCCGC
AGACCGTGTTCCAGATCCTGCCGCAACCGAGCACGGGCACGACGGAATACACGATCGCGATCGACGGCCA
GCAGCTGCGCTACCGCAACACGCCGCCGCAGTGGACCAACTTCGTGTGGCCGAACCCGCAGGGTTCGCCG
GGCGCGACGCTGTCCGCGACGACCTTCGACGGCCGCACGGTGCAGCTCGTCAACGAGCCGGGCCGCTACG
GTCTCGAGAAGCTGATCAACTCGGCGCAGCGCAAGCGCCGTCCGGATGGCACCTTCGACCTGACGTGGGC
ACAGGGCAGCGTGAACGTGTCGGTGACGATGCGCATCATCAGCACGTCGCAACCGTCGGCCGGTGGCGGC
GACCAGCCGCAGCAGCAAAGCCTGCGCGGCCTGCAGCTGCCGTCGTCGGTCGCCGACGCGAGCGCGGGCG
CCGCGCAGAACGCGACGCAAGCCGGCACCGGCACGCCGGGCGCCGCGCCGGCGGTCGCGGCCGCCAACGC
AACGAATGCACAGAGGGCGCAATGA
 Primer design