SecReT6
Protein ID: 206576125
SecReT6 ID305
T6SS typeN/A
Gene symbol-
Locus tagKPK_2041
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]2103631..2104971 [+]
Producthypothetical protein
NoteTssK
UniProt IDB5XW23
KEGG IDkpe:KPK_2041
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.50E-131, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|206576125|ref|YP_002237880.1| unnamed protein product [Klebsiella pneumoniae 342]
MKIFRPLWRDGAFLVPQQFQQQARWDAHVADTVSRMALAHPWGVLRAEFDASALTLSRLNATRLIVRFAD
GTLIDTELADTLPPVCDVSGVMLDSVEVVLALPLLSASGGNLDDGQESARPRRWRAEQVTVQELAGHERS
ELAVLRHALTLRLSTEENAAFLTCPVARLVRDAQGQWIVDPEFIPPLLSLAASPTLVSELGELLHRLQAR
RRRLMAMRRESNARMADFAVADVSLFWLLNALNSAEPVLSELHQDPSRHPELLYRELARLAGSLMTFSLE
HHLEAIPRYRHASPEQVFPPLFALLDTLLEVSLPSRVIAIALEQGADREIWRGRLHDARLREGADFYLSV
RSSLPPHQLQSRFPQLCKAGSHDDVAEVVNIALSGIAIKPLSHVPAAIPLRLENQYFALDLSTDAARAML
EAGNCTFYTPESLGDVKLELFAVLRS
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|206575712|ref|NC_011283.1|:2103631-2104971 Klebsiella pneumoniae 342 chromosome, complete genome
ATGAAGATTTTCCGCCCATTATGGCGCGACGGGGCTTTTCTGGTCCCGCAGCAGTTTCAGCAACAGGCTC
GCTGGGATGCGCACGTCGCCGATACGGTCTCCCGCATGGCGCTCGCCCACCCGTGGGGGGTATTGCGCGC
GGAGTTTGACGCCAGCGCGCTCACCCTTTCCCGGCTCAACGCCACCCGGCTGATCGTTCGTTTCGCCGAC
GGAACGCTGATTGACACCGAGCTGGCGGATACTCTGCCACCGGTCTGTGATGTCTCGGGCGTGATGCTGG
ACAGCGTGGAGGTTGTGCTTGCTCTGCCGCTGCTCAGCGCCAGCGGCGGCAATCTTGATGACGGCCAGGA
GAGCGCCCGCCCGCGCCGCTGGCGCGCCGAGCAGGTGACCGTGCAGGAGCTGGCCGGCCATGAACGCAGC
GAGCTGGCCGTTCTGCGGCACGCGCTGACGCTGCGTCTCTCCACCGAGGAAAACGCGGCCTTCCTCACCT
GCCCGGTAGCGCGTCTGGTGCGCGACGCCCAGGGGCAGTGGATCGTTGACCCGGAATTCATCCCGCCGCT
GCTGTCGCTGGCAGCAAGCCCGACGCTGGTCAGCGAGCTGGGCGAGCTGTTACATCGCCTGCAGGCCCGA
CGCAGACGCCTGATGGCCATGCGCCGTGAAAGCAATGCGCGGATGGCTGATTTTGCCGTGGCGGATGTTT
CCCTGTTCTGGCTGCTCAACGCGCTGAACAGCGCCGAGCCGGTGCTCAGCGAGCTGCATCAGGACCCTTC
GCGCCATCCGGAGCTGCTCTATCGTGAACTGGCCAGGCTGGCCGGCAGTCTGATGACCTTCTCCCTTGAA
CATCATCTGGAAGCTATCCCCCGCTACCGGCATGCCTCGCCGGAGCAGGTATTCCCGCCGCTGTTTGCCC
TGCTGGATACGCTGCTCGAAGTCAGCCTGCCCTCAAGGGTGATCGCCATCGCTCTGGAGCAGGGCGCCGA
CCGGGAGATCTGGCGGGGCAGGCTACACGATGCGCGACTGCGCGAGGGGGCGGATTTTTATCTGTCGGTG
CGCTCTTCACTCCCCCCTCACCAGCTACAGAGCCGCTTTCCGCAGCTCTGTAAGGCGGGTAGCCATGATG
ATGTCGCTGAGGTCGTCAACATTGCCCTCAGCGGCATCGCGATCAAACCGCTGAGCCACGTGCCGGCGGC
CATTCCGCTACGTCTGGAAAACCAATATTTCGCTCTGGATCTCTCCACCGATGCCGCCCGCGCGATGCTG
GAGGCCGGCAACTGCACCTTCTATACCCCGGAATCGCTTGGCGACGTGAAACTTGAACTCTTTGCGGTAC
TGCGCTCATGA
 Primer design