SecReT6
Protein ID: 206576260
SecReT6 ID304
T6SS typeN/A
Gene symbol-
Locus tagKPK_0939
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]946468..949803 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDB5XUW2
KEGG IDkpe:KPK_0939
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.90E-69, Aligned region: 397..715
DUF1215 [PF06744], Evalue: 6.30E-36, Aligned region: 433..464
DUF1215 [PF06744], Evalue: 6.30E-36, Aligned region: 836..955
Protein Sequence: 1111 a.a.     [Download]
>gi|206576260|ref|YP_002236811.1| unnamed protein product [Klebsiella pneumoniae 342]
MHTARYGFWGYLLLIIGLAGICALLIFINQDLLARRGVSAQQAWSLWGGIFAILLFGLVCSPFWWLRKQK
KEQTIYRPEVPAKNEKRLSDDFYILLKSKLRSRYGLLWRHKVRLLLVMGESTQVEAIAPGLTAQRWQEGE
YTVLIYGGSASAAPDTTLLTSLKRLRHFRPLDGIIWPLTEKQCCQTAQLDKGWRELATCGKLLGFQAPLY
LWQVCDDGGYQAGRTLQSVGCLLPERCVPEQLASLLEARTLQLTAQGVQQLLNNDHHDFLLRLAHQLAEG
GIVKWKTALKPLLAGGAFSCLQLRGLMFSPPLTPAPEAAIHAWLPSPVWLGVTGDNARGRRVGFPWWRTM
LAICACVLAVWVAGMMTSFFANRALIQETAIQATRARDIRLPLSEQLAALHTLQSQLERLQYRIRHGAPW
YQRFGLERNAHLLSAAFPGYAQAANRLVRDVAAAYLQQQLNAFVALPPNSPQRTATGEQRYKQLKALLMM
SRPEKSDAAFFSTTLMAEHLRYAAVPEGTRQSVLPSLLTFWMANLPEHPQWKIAPQPQLTGAVRKILLRQ
IGVRNAENTLYQNVLKQVSRNYADITLADMTGDTLADPLFSTEQTVPGMFTRQAWEGQVKEAIEQVVTAR
REEIDWVLSDRRQDASADISPEVLRARLTTRYFTDFAGSWQAFLNSIRWKKEDSLSGVLDQLTLMADARQ
SPLIALTDTVAWQAATGRESAGLSDSLVKSAKALFNGKENTSHVVRKDETPAGPMDKTFAPLLRLIGDTT
GGRGDTQLSLQTWLTRVTRVRLKLQQVINAPDPQEMTQQLAQTVFQGKTVDLTDTRDYGRLIAASLGEEW
SGFGQSLFVSPVEQAWRQVLTPAADSLNRQWQRAIVNLWEQDFAGRYPFKDTANDASLPLLAQYLRDDGR
INQFIATNLTGMLKREGRYWVADTMNTQGLAINPAFLRALNRLRDVADTAFASGDAGVHFELMAKPARDV
MKTHLVIDGQQLEYFNQKERWQRFSWPHEQWQPGASLSWTSTQNMERILADFRGSWSFIRLLEQAQVTQL
DSSSFKLQWQAPDGLPLHYLMRVEQGKGPLALLTLKNFRLPGQLFLTEKGAADRREYGEDE
 
Nucleotide Sequence: 3336 bp     [Download]
>gi|206575712|ref|NC_011283.1|:c949803-946468 Klebsiella pneumoniae 342 chromosome, complete genome
ATGCATACTGCGCGCTATGGTTTCTGGGGCTATCTTCTTCTTATTATAGGGCTGGCAGGAATTTGTGCCT
TATTGATTTTCATTAATCAGGATTTGTTGGCAAGGAGAGGAGTATCCGCCCAACAAGCGTGGTCACTATG
GGGAGGGATATTTGCAATCCTGTTATTCGGACTGGTGTGTTCACCATTCTGGTGGCTCAGGAAACAAAAG
AAAGAGCAGACGATTTATCGGCCTGAAGTGCCGGCCAAAAATGAAAAGCGACTATCTGATGATTTTTACA
TCCTTCTTAAATCAAAACTTCGGTCCCGCTATGGCCTGCTCTGGCGACATAAAGTCCGCCTGCTATTGGT
GATGGGTGAATCGACGCAGGTGGAAGCGATTGCACCAGGATTAACGGCGCAGCGCTGGCAGGAAGGCGAG
TACACAGTGTTAATATACGGAGGCTCCGCGTCGGCAGCCCCGGATACGACACTTTTGACATCCCTGAAAA
GACTGCGCCATTTCCGTCCGCTGGACGGCATTATCTGGCCGCTGACGGAAAAACAATGTTGCCAGACGGC
GCAACTGGATAAAGGTTGGCGTGAGCTGGCTACCTGCGGAAAATTGCTCGGTTTTCAGGCCCCGTTATAT
CTGTGGCAAGTTTGTGATGACGGTGGTTATCAGGCTGGGCGTACGCTACAAAGCGTCGGTTGCCTGTTGC
CTGAACGCTGCGTGCCGGAACAACTGGCGTCGCTGCTGGAAGCGCGGACACTGCAGTTGACCGCACAGGG
AGTACAGCAGTTACTGAATAACGACCACCACGATTTCCTGTTACGGCTTGCCCATCAGCTCGCTGAAGGC
GGTATTGTTAAATGGAAGACGGCGCTAAAACCGCTCCTTGCCGGTGGCGCGTTTTCTTGCCTGCAACTGC
GTGGTCTGATGTTCAGCCCTCCGCTTACCCCCGCGCCAGAGGCCGCGATCCACGCATGGTTGCCATCGCC
GGTATGGTTGGGCGTGACTGGCGATAATGCGCGGGGGCGCAGAGTGGGTTTTCCGTGGTGGCGCACTATG
TTAGCGATCTGCGCCTGTGTGCTGGCGGTATGGGTGGCCGGAATGATGACCTCCTTTTTCGCCAACCGTG
CCCTGATTCAGGAAACCGCGATACAGGCGACGCGGGCGCGTGATATCCGCCTGCCGCTTTCAGAACAACT
GGCCGCACTGCATACCTTACAGAGCCAACTCGAGCGTCTGCAGTACCGTATTCGCCACGGTGCGCCGTGG
TATCAGCGTTTCGGTCTTGAACGTAACGCGCATCTGCTCAGCGCCGCCTTTCCTGGTTATGCCCAGGCAG
CAAACCGGCTGGTGCGCGATGTCGCAGCCGCGTATCTGCAGCAACAATTGAACGCCTTTGTCGCCCTGCC
GCCGAACAGTCCGCAACGCACCGCAACGGGAGAACAGCGCTATAAACAGCTTAAGGCGCTGCTGATGATG
TCCCGCCCGGAAAAATCTGACGCCGCCTTTTTCAGCACCACGCTGATGGCAGAGCATCTGCGCTATGCAG
CTGTACCGGAAGGTACCCGGCAAAGCGTGCTGCCATCGCTGCTGACCTTCTGGATGGCTAATCTGCCGGA
GCATCCACAGTGGAAAATCGCCCCGCAGCCGCAACTGACCGGCGCGGTACGCAAAATTCTGCTGCGCCAG
ATTGGGGTGCGCAATGCGGAAAACACCCTCTATCAGAACGTCCTGAAACAGGTCTCCCGTAACTATGCCG
ATATCACGCTGGCAGACATGACCGGCGACACGCTGGCAGACCCGCTTTTCAGTACCGAACAGACCGTACC
GGGAATGTTTACCCGTCAGGCATGGGAAGGACAGGTAAAAGAGGCAATAGAACAAGTGGTCACCGCCCGG
CGCGAGGAAATCGACTGGGTGCTCAGTGACCGTCGGCAGGACGCATCCGCCGATATCTCGCCTGAGGTGC
TGCGCGCCCGCCTGACCACACGCTACTTCACCGATTTCGCCGGTAGCTGGCAGGCCTTCCTCAACAGTAT
TCGCTGGAAAAAAGAGGACTCGCTTTCCGGCGTGCTTGACCAGTTAACGCTGATGGCTGATGCCCGCCAG
TCGCCGCTGATTGCGCTCACGGATACCGTGGCATGGCAGGCGGCAACCGGAAGGGAAAGCGCAGGCCTGT
CGGATTCATTGGTAAAGTCGGCAAAAGCACTGTTTAACGGCAAGGAAAATACGTCGCATGTCGTCCGTAA
AGATGAAACACCGGCGGGACCAATGGACAAAACGTTTGCCCCGCTGCTGCGACTGATCGGGGATACAACC
GGAGGGCGGGGTGATACTCAGCTCAGCCTGCAAACCTGGCTGACCCGCGTCACCCGTGTGCGCCTCAAGC
TACAACAGGTGATTAACGCCCCCGACCCGCAGGAGATGACCCAGCAGCTGGCGCAGACCGTATTTCAGGG
GAAAACGGTCGATCTTACCGATACCCGCGATTATGGCCGTCTGATAGCCGCCAGTCTGGGTGAAGAATGG
AGTGGTTTTGGCCAGTCGTTGTTTGTTAGCCCGGTGGAGCAGGCATGGCGACAGGTGCTGACGCCCGCAG
CGGATAGCCTTAACCGGCAGTGGCAGCGCGCTATTGTCAACCTCTGGGAGCAGGATTTTGCCGGGCGCTA
CCCGTTCAAAGACACAGCGAATGACGCCTCACTTCCCCTGCTGGCGCAGTACCTGCGTGACGACGGGCGG
ATAAATCAGTTTATTGCCACCAACCTCACCGGAATGTTGAAACGCGAAGGCCGGTACTGGGTGGCTGACA
CCATGAACACGCAGGGACTGGCGATCAACCCGGCGTTTTTACGCGCCCTGAATCGCCTGCGCGATGTGGC
CGACACAGCCTTTGCCAGCGGCGATGCCGGGGTACATTTTGAACTGATGGCAAAACCGGCACGTGACGTG
ATGAAAACGCATCTGGTGATTGACGGCCAGCAACTGGAATATTTCAACCAGAAAGAACGCTGGCAGCGTT
TCAGCTGGCCGCATGAGCAGTGGCAGCCCGGCGCATCGCTGAGCTGGACCAGTACGCAGAATATGGAACG
TATTCTGGCCGACTTCCGGGGAAGCTGGAGTTTTATTCGTCTGCTGGAACAGGCGCAGGTCACACAGCTG
GACAGCAGCAGCTTTAAGCTGCAGTGGCAAGCGCCGGACGGTCTGCCGCTGCATTACCTGATGCGCGTCG
AGCAGGGCAAAGGCCCGTTGGCGCTTCTGACGCTGAAAAACTTCCGCCTGCCAGGGCAGCTATTCCTGAC
AGAGAAAGGGGCGGCGGACAGGAGGGAATATGGAGAGGATGAGTGA
 Primer design