SecReT6
Protein ID: 206576798
SecReT6 ID305
T6SS typeN/A
Gene symbol-
Locus tagKPK_2056
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]2122744..2123187 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB5XW38
KEGG IDkpe:KPK_2056
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.10E-16, Aligned region: 26..113
Protein Sequence: 147 a.a.     [Download]
>gi|206576798|ref|YP_002237895.1| unnamed protein product [Klebsiella pneumoniae 342]
MPRPSLYDILYGNFAGGLDLNTVSETDQVILSVLDNMQRILNCRAGTLAHLPDYGLPDMTAILQGMPASA
HQLMSTLSAVLLKYEPRLQRIAVVMLDQHAPGELRYAIDAELKDIGLVRYGTEFMPEGRVLIRHLKRQQY
LDARSAL
 
Nucleotide Sequence: 444 bp     [Download]
>gi|206575712|ref|NC_011283.1|:2122744-2123187 Klebsiella pneumoniae 342 chromosome, complete genome
ATGCCTCGTCCCTCCCTGTATGACATCCTGTACGGCAACTTCGCCGGCGGGCTTGACCTGAATACTGTCA
GCGAGACGGATCAGGTCATCCTGTCGGTGCTCGATAACATGCAGCGCATCCTCAACTGTCGGGCTGGAAC
GCTGGCGCATCTGCCGGACTACGGCCTGCCGGATATGACCGCTATCCTCCAGGGGATGCCGGCGTCGGCG
CATCAGCTGATGAGCACGTTGTCGGCGGTATTGTTGAAGTACGAACCGCGCCTGCAGCGGATCGCGGTGG
TGATGCTCGATCAGCATGCGCCCGGCGAACTGCGCTATGCCATTGATGCGGAGCTGAAGGATATTGGCCT
GGTGCGTTACGGCACAGAGTTTATGCCCGAGGGCAGGGTGTTGATCCGCCACCTCAAACGCCAGCAGTAC
CTTGACGCCCGCTCCGCCCTCTAA
 Primer design