SecReT6
Protein ID: 206577657
SecReT6 ID305
T6SS typeN/A
Gene symbol-
Locus tagKPK_2043
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]2105625..2107322 [+]
ProductOmpA domain-containing protein
NoteTagL
UniProt IDB5XW25, B5XW25
KEGG IDkpe:KPK_2043
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 7.00E-18, Aligned region: 435..531
DUF4381 [PF14316], Evalue: 0.0057, Aligned region: 23..61
Protein Sequence: 565 a.a.     [Download]
>gi|206577657|ref|YP_002237882.1| unnamed protein product [Klebsiella pneumoniae 342]
MRDNARRLLTLLTVILALWLVLGFWPLSIGNQVIFSLCILLAGGAALWRQRRRAVSRQRSEIVLPPEDFQ
GAVVLVCGDTDSLFPGRSAHCETRHGWYLRGDSAEQLPLLAQYLAAARPGLVSQVSVLLAVVPEHHPSGE
QLAQSLRDWRRSIVQCRTWLNGLPPVWSVFWVTPPGGQAGESRWFTVTPERPGLQVQQKGQAPQSVAEWQ
REGSPASRLHQTLWLESILTLAENALFRPFRARQAELPPLNLCAAGICLTPMVAAANNLWQQQIAGITTL
SPGNAAAPGPHPLPDLLLSSLPHRHGVSRRIRDAGLAAGVGFLFLALAMLASFINNQRLVRSVGDHLAVY
HRLSGTPPTPKLQAQQRLRTDSRQLDDWLRRGEPLRYRLGLYQGMRLIPFVEAAINDWAPPPPPRPVIKQ
VVQGPQTIRLDSMALFDTGKSTLKPGSTKLLVNSLLGIKAKPGWLIVVAGHTDSIGNDKSNQQLSLKRAE
AVRDWMRDTGDVPESCFAVQGYGASRPVASNETPEGRAKNRRVEISLVPQKDACLTPGTANTSGAGADAL
KNETK
 
Nucleotide Sequence: 1698 bp     [Download]
>gi|206575712|ref|NC_011283.1|:2105625-2107322 Klebsiella pneumoniae 342 chromosome, complete genome
ATGCGTGATAACGCCCGTCGTCTGCTTACGCTACTGACCGTCATCCTGGCCCTGTGGCTGGTGCTGGGCT
TCTGGCCGCTGTCCATCGGCAACCAGGTGATCTTCAGTCTGTGCATCCTGCTGGCGGGCGGCGCGGCGCT
CTGGCGTCAGCGTCGCCGGGCAGTCAGCCGTCAGCGATCGGAAATCGTCCTGCCGCCCGAGGATTTTCAG
GGGGCGGTGGTTCTGGTCTGCGGGGATACCGACAGTCTGTTTCCCGGGCGTTCGGCGCACTGCGAAACCC
GTCACGGCTGGTATCTACGGGGAGACAGCGCGGAGCAGTTGCCGCTGCTGGCGCAGTACCTGGCGGCGGC
GCGTCCGGGGCTGGTATCGCAGGTTTCCGTGCTGCTGGCGGTGGTACCGGAGCACCACCCCTCCGGGGAG
CAACTGGCGCAGTCGCTGCGCGACTGGCGACGGAGTATCGTTCAGTGCCGAACCTGGCTAAACGGTCTGC
CGCCGGTGTGGAGCGTGTTCTGGGTGACGCCGCCTGGCGGCCAGGCAGGGGAAAGCCGCTGGTTTACCGT
CACGCCGGAGAGGCCTGGTCTCCAGGTGCAGCAGAAGGGGCAAGCGCCCCAGTCGGTTGCCGAGTGGCAG
CGGGAGGGCAGCCCTGCCTCACGCCTGCATCAGACGCTGTGGCTGGAGAGCATTCTGACCTTGGCCGAAA
ACGCTCTTTTCCGGCCATTCCGCGCCCGGCAGGCGGAACTTCCTCCGCTGAACCTGTGTGCCGCGGGCAT
CTGCCTGACACCGATGGTAGCGGCGGCAAATAACCTCTGGCAACAGCAAATCGCCGGGATCACCACGCTC
TCCCCGGGCAACGCCGCGGCGCCAGGTCCTCACCCGCTGCCGGATCTTCTGCTGTCGTCACTGCCGCACC
GCCACGGGGTCAGCCGCCGGATACGCGATGCCGGTCTTGCCGCTGGCGTGGGCTTCCTCTTTCTGGCGCT
GGCGATGCTGGCTTCCTTTATCAACAACCAGCGCCTGGTGCGCAGCGTCGGCGATCATCTGGCGGTGTAT
CACCGCCTCAGCGGCACGCCGCCGACGCCGAAGCTGCAGGCGCAGCAGCGTCTGCGTACCGACAGCCGCC
AGCTGGATGACTGGCTGCGCCGGGGAGAGCCGTTGCGTTACCGGCTGGGGCTGTATCAGGGGATGCGGCT
GATCCCCTTCGTGGAAGCCGCTATCAATGACTGGGCGCCGCCCCCGCCGCCGCGTCCGGTCATTAAGCAG
GTTGTGCAGGGGCCGCAGACGATCCGCCTCGATAGCATGGCGCTGTTCGATACCGGCAAATCGACGCTGA
AACCGGGTTCGACAAAGCTGCTGGTGAACTCGCTGCTGGGCATTAAGGCGAAACCCGGCTGGCTGATCGT
GGTGGCAGGCCATACCGACAGCATCGGCAACGATAAATCCAATCAACAACTCTCCCTGAAGCGTGCCGAG
GCGGTCCGCGACTGGATGCGCGATACCGGCGATGTGCCGGAGAGCTGTTTTGCGGTGCAGGGCTACGGCG
CAAGTCGTCCTGTCGCCAGCAACGAGACGCCAGAGGGGCGGGCGAAAAATCGCCGGGTGGAGATCAGTCT
GGTCCCGCAGAAGGACGCCTGTCTGACACCGGGCACGGCTAATACGTCAGGAGCCGGGGCTGACGCCTTA
AAAAACGAAACCAAGTAA
 Primer design