SecReT6
Protein ID: 206578041
SecReT6 ID305
T6SS typeN/A
Gene symbol-
Locus tagKPK_2057
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]2123207..2124592 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB5XW39
KEGG IDkpe:KPK_2057
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.80E-50, Aligned region: 36..62
DUF3702 [PF12486], Evalue: 2.80E-50, Aligned region: 90..174
DUF3702 [PF12486], Evalue: 2.80E-50, Aligned region: 301..445
ImpA-rel_N [PF06812], Evalue: 6.40E-18, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 6.40E-18, Aligned region: 322..338
ImpA-rel_N [PF06812], Evalue: 6.40E-18, Aligned region: 347..370
Protein Sequence: 461 a.a.     [Download]
>gi|206578041|ref|YP_002237896.1| unnamed protein product [Klebsiella pneumoniae 342]
MMTTHDERHYKTGGDPRTLADFIALRAEMNKLSHPARPDINWPYAEQLARSLLEHHGADLQTVAWYTLAR
ARLGGLAGIHEGLSLMESLLAHQGKNLWPQALPARTEIFRTLSKRLRQVIRTLSLAPADLESLGQAERSL
QSFDAVLQRLEIAPENPLSDLRALLHSTVSRFENLDPAPALPTAPPVAVSDAELPGALVSEEDAAKVEPV
PELKRRPKAEPLAPPLPAKRPAPVVASSPAPAPRWKPFVAGMVTMLAVTGIAVGGWLALRQSDLPPISVT
QNVIPGLPGASPLMPVDLPQTQRQLGELARLAPDWAVSYGDQLVRQALSRWPDQAQPLAQQWRQQLSAAA
LPAENLTGWSEGMQQLQRLAGQLNALDEQKGRYLTVSELKTAVFAIMQSFNRAVPLEEELRQLAVLPVEQ
PWPAARGSLAELHLQQLIVEYALLKRKQSPPAEIPLPVSPR
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|206575712|ref|NC_011283.1|:2123207-2124592 Klebsiella pneumoniae 342 chromosome, complete genome
ATGATGACAACACACGACGAACGCCACTATAAAACCGGTGGCGACCCGCGCACGCTGGCTGATTTTATTG
CCCTGCGTGCGGAAATGAACAAGCTCAGCCACCCGGCGCGGCCGGATATTAACTGGCCGTATGCCGAGCA
GCTTGCCCGCTCGCTGCTGGAGCATCACGGCGCGGATCTGCAGACTGTCGCCTGGTATACGCTGGCCCGC
GCCAGGCTGGGCGGGCTGGCAGGGATCCACGAGGGGCTGTCGCTAATGGAGTCGCTGCTGGCCCACCAGG
GGAAAAACCTGTGGCCGCAGGCGCTCCCGGCCCGGACAGAGATCTTCCGCACCCTGAGCAAGCGGCTGCG
GCAGGTGATCCGCACTCTGAGTCTCGCCCCGGCGGATCTCGAGTCGCTTGGTCAGGCTGAACGTTCGCTG
CAAAGCTTCGACGCAGTGCTCCAGCGCCTTGAGATCGCGCCTGAAAACCCGCTGAGCGACCTGCGGGCGC
TGCTGCACAGCACGGTAAGCCGCTTCGAGAATCTCGACCCTGCGCCAGCGCTCCCCACCGCGCCGCCGGT
GGCGGTGTCTGACGCGGAACTTCCCGGCGCTCTGGTCAGCGAAGAGGATGCGGCAAAGGTTGAACCCGTG
CCAGAACTAAAACGTAGACCAAAGGCTGAGCCGCTGGCGCCGCCTTTACCTGCAAAGCGGCCCGCGCCAG
TGGTGGCGTCCTCTCCGGCACCCGCGCCGCGCTGGAAGCCGTTTGTCGCCGGGATGGTCACCATGCTGGC
GGTGACGGGCATCGCCGTCGGTGGATGGCTGGCGTTGCGTCAGTCCGATTTACCGCCCATTTCGGTGACC
CAAAATGTGATACCGGGCCTGCCGGGGGCATCTCCCCTGATGCCGGTGGATCTGCCTCAGACGCAGCGCC
AGCTTGGCGAGCTCGCCCGCCTGGCGCCGGACTGGGCGGTAAGCTACGGCGACCAGCTGGTCCGGCAGGC
CCTGAGTCGCTGGCCGGATCAAGCACAACCGCTGGCGCAGCAGTGGCGGCAGCAGTTGAGCGCTGCCGCA
TTGCCCGCGGAAAACCTCACCGGCTGGTCCGAGGGAATGCAGCAGCTGCAGCGGCTCGCCGGCCAGCTCA
ATGCCCTCGACGAGCAGAAGGGGAGATACCTCACGGTGAGCGAACTGAAAACCGCAGTGTTTGCCATCAT
GCAGTCGTTTAACCGCGCCGTTCCGCTGGAGGAGGAGCTACGCCAGCTGGCCGTGCTTCCCGTTGAGCAA
CCCTGGCCTGCCGCCCGGGGAAGCCTCGCGGAGCTGCATCTGCAACAACTGATCGTGGAGTATGCCCTGC
TGAAGCGAAAGCAGTCGCCGCCCGCTGAGATCCCCCTACCGGTAAGCCCTCGGTGA
 Primer design