SecReT6
Protein ID: 206578179
SecReT6 ID305
T6SS typeN/A
Gene symbol-
Locus tagKPK_2054
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]2121133..2122224 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDB5XW36
KEGG IDkpe:KPK_2054
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.00E-82, Aligned region: 23..324
Protein Sequence: 363 a.a.     [Download]
>gi|206578179|ref|YP_002237893.1| unnamed protein product [Klebsiella pneumoniae 342]
MYPVERESQSAPARLMAQLRPQLPYMNFYRFCQLLEKNHPKAPVIGSGWLLGDEPIRFRPHPGMGFPAGE
IRGMDDPEPPRPPAVRVAFMGLYGVESPLPTHYSDDIAQRREGVEATEDFLDIFNHRLIAQYYRIWRKYS
YPATFRAGGTDNTSQYLLGLAGLGIPGCATVAAAPLSRFLALLPVMMLPGRSGEGMEALVALLAPGTRAT
VYHHDPCRIPLSQPLTMSIRQPVSLQHRPVMGTHATDVNSQVLLQLATENPDEVRGWLPGGELFSDLMAL
LHVWLGSHLDVRLQLCVARHLLPDAQLCCQQAHAVQLGRTAVLRPLDAQKQADDRITIYLGRYQRVRENI
HRRESDEDGDYRR
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|206575712|ref|NC_011283.1|:2121133-2122224 Klebsiella pneumoniae 342 chromosome, complete genome
ATGTATCCGGTGGAAAGAGAATCACAGTCTGCGCCTGCCCGGCTGATGGCTCAGCTCCGGCCTCAGTTGC
CGTACATGAATTTTTACCGCTTCTGCCAGTTGCTGGAGAAGAACCATCCGAAGGCGCCGGTCATCGGCAG
CGGCTGGCTATTAGGTGATGAACCCATACGCTTTCGCCCGCATCCGGGGATGGGCTTTCCGGCCGGCGAA
ATCCGTGGAATGGACGATCCTGAACCGCCCCGACCGCCGGCGGTTCGCGTTGCTTTTATGGGGCTCTACG
GCGTGGAATCCCCGCTGCCGACCCACTATAGCGATGACATTGCGCAACGGCGGGAAGGCGTCGAGGCGAC
CGAGGATTTTCTCGATATCTTTAACCATCGGCTGATCGCCCAGTATTACCGTATCTGGCGCAAATATTCC
TACCCGGCAACCTTTCGGGCGGGGGGCACGGACAACACCTCGCAGTATCTGCTGGGCCTGGCGGGGCTGG
GCATACCGGGATGTGCCACCGTTGCCGCAGCGCCGCTGTCGCGATTTCTGGCGTTGCTGCCGGTGATGAT
GCTGCCGGGGAGATCCGGGGAAGGCATGGAGGCGCTGGTGGCGCTCCTGGCCCCGGGGACCCGGGCGACG
GTGTACCACCACGATCCCTGCCGGATCCCCTTGTCGCAGCCGTTAACGATGAGCATCCGCCAGCCGGTTA
GCCTGCAACACAGGCCAGTGATGGGAACTCACGCCACGGATGTGAACAGTCAGGTGTTGCTGCAGCTAGC
CACGGAGAATCCTGATGAGGTTCGCGGCTGGCTGCCCGGCGGCGAACTGTTCAGCGACCTGATGGCGCTC
CTGCACGTCTGGCTCGGATCTCATCTCGACGTGCGGCTGCAGCTTTGCGTCGCCCGCCATTTACTGCCGG
ATGCGCAACTTTGCTGCCAGCAGGCGCATGCCGTCCAGCTTGGCCGTACCGCTGTGCTGCGTCCGCTGGA
TGCGCAGAAACAGGCTGACGACAGGATCACGATTTATCTGGGGCGCTATCAGCGCGTCCGGGAAAATATC
CACCGCAGGGAGAGCGATGAAGATGGCGATTACCGCAGATAA
 Primer design