SecReT6
Protein ID: 206578427
SecReT6 ID305
T6SS typeN/A
Gene symbol-
Locus tagKPK_2042
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]2104968..2105621 [+]
Producttype IV/VI secretion system protein, DotU family
NoteTssL
UniProt IDB5XW24
KEGG IDkpe:KPK_2042
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-43, Aligned region: 10..205
Protein Sequence: 217 a.a.     [Download]
>gi|206578427|ref|YP_002237881.1| unnamed protein product [Klebsiella pneumoniae 342]
MNTSESDLINKTFYPGWLMVSQLRCGQPVTDGEALYRQACRWVTEAREALTAAGISDTSAEQMLYAYCAL
LDESVLNRASQDDGYRRWRKDPLQARFFSTLNAGEELWERIRQLLREPTADAAVLTCFYRTLQLGFVGQY
RAQDDERREDVAHALGARVPPFSLTQEAPVVVRASRLRSGRRMYWCGWAVGIVALAALWLTFSAVLSQMV
AKIAGQG
 
Nucleotide Sequence: 654 bp     [Download]
>gi|206575712|ref|NC_011283.1|:2104968-2105621 Klebsiella pneumoniae 342 chromosome, complete genome
ATGAATACCTCTGAAAGCGATCTGATCAACAAAACTTTTTACCCGGGCTGGCTGATGGTCAGCCAGTTAC
GCTGCGGCCAGCCGGTGACCGATGGCGAGGCGCTCTATCGTCAGGCCTGTCGATGGGTGACCGAGGCGCG
CGAGGCGCTGACGGCGGCAGGAATCAGTGACACCAGCGCTGAGCAGATGCTCTATGCCTACTGCGCGCTG
CTGGATGAGAGCGTCCTCAACCGCGCCAGTCAGGATGATGGCTACCGCAGGTGGCGCAAGGATCCGCTGC
AGGCGCGTTTTTTCAGCACTCTCAACGCCGGGGAAGAGCTCTGGGAACGGATCCGCCAGCTGCTGCGAGA
GCCCACGGCGGATGCGGCAGTGCTGACTTGTTTCTATCGTACTTTGCAACTGGGGTTTGTCGGGCAGTAC
CGCGCCCAGGATGACGAACGGCGTGAGGACGTGGCGCATGCGCTTGGCGCACGGGTCCCGCCGTTCAGCC
TGACCCAGGAGGCGCCGGTGGTGGTTCGTGCCTCCCGGCTGCGCAGCGGACGGCGGATGTACTGGTGCGG
CTGGGCGGTTGGCATTGTGGCGCTGGCCGCGCTGTGGTTGACCTTCTCCGCCGTGCTGTCACAGATGGTG
GCGAAGATAGCAGGGCAGGGATAA
 Primer design