SecReT6
Protein ID: 206578488
SecReT6 ID305
T6SS typeN/A
Gene symbol-
Locus tagKPK_2053
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]2119415..2121178 [+]
Producthypothetical protein
NoteTssF
UniProt IDB5XW35
KEGG IDkpe:KPK_2053
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.70E-182, Aligned region: 6..582
Protein Sequence: 587 a.a.     [Download]
>gi|206578488|ref|YP_002237892.1| unnamed protein product [Klebsiella pneumoniae 342]
MDDLTLRYFDAEMRYLREAAKAFAQAHPDRAAMLDLDKAGTPDPYVERLFEGFAFSVGRLREKIDDDLPE
LTEGLVSMLWPHYLRTIPSLSIVALTPTLPAMKMAETAPAGFEISSRPLGPKNTVCRYRTTRDLTLNPLA
LEEAVMTAEPDGRSVLRLCFTCSELADWSQTDLRRLALYLGEDAVTGSALHLWLTRRQAALYLRLPGRAE
RVSLDGYFSPGGFSEEDRLWPKGESAFSGYQLLLEYFTFREKFMFVQLNGLENITLPAGISHFTLEVVFS
EVWQSDLPVSASSLRLHCVPVINLFTLEADPLTISGLESEYLLRPKRMQDGHTEIYSVDSVTGSGRTGEA
RYVPFTRFRHQGGMMRRHAPERYYHTRVKRGVTGMHDTWLILGGQQWESDRALARETVSLRITGTNGQLP
RRALQSTLLDRCESISATPLTVRNLCKPTLPVYPPAEDRYHWRVMSHLGTRFLNMMSSAEVLRGTLSLYN
WREDELNNRRLDAILAVSHHRIQRFEQGFLLRGLDIEVTLDGSGFTGAGDVHLFGDMLNRFFALYADMNQ
FNQLTLIVQPEGKCIRWKENHSLRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|206575712|ref|NC_011283.1|:2119415-2121178 Klebsiella pneumoniae 342 chromosome, complete genome
ATGGACGATTTAACCCTGCGATATTTTGACGCTGAAATGCGCTACCTGCGCGAGGCGGCAAAAGCGTTCG
CGCAGGCTCACCCCGATCGGGCGGCGATGCTGGATCTCGATAAAGCCGGTACGCCGGACCCTTACGTTGA
GCGCCTGTTTGAAGGCTTTGCCTTTTCCGTAGGTCGCTTGCGCGAAAAAATTGATGATGATCTGCCGGAG
CTGACCGAGGGGCTGGTCAGCATGCTGTGGCCGCACTATTTGCGCACCATTCCATCGCTATCGATCGTGG
CGCTGACCCCAACGCTGCCGGCGATGAAGATGGCGGAAACGGCGCCCGCCGGGTTTGAGATAAGCTCCCG
CCCACTGGGGCCGAAAAATACCGTGTGCCGGTACCGAACCACCCGCGATCTGACGCTTAATCCGCTGGCG
TTAGAGGAGGCGGTGATGACGGCAGAGCCGGACGGACGTTCGGTCCTGCGGCTATGCTTCACCTGTAGCG
AGCTGGCGGACTGGTCGCAGACCGATCTCCGCCGCCTGGCGCTGTACCTGGGGGAAGACGCCGTTACCGG
CAGCGCCCTCCATCTGTGGCTGACCCGACGCCAGGCCGCGCTGTACCTGCGCCTGCCGGGTCGGGCAGAG
CGGGTAAGCCTCGACGGCTATTTTTCCCCGGGGGGATTCAGCGAGGAGGATCGTTTATGGCCGAAGGGGG
AGAGCGCTTTCAGCGGCTATCAGCTGCTGCTCGAGTATTTCACCTTTCGCGAAAAATTTATGTTCGTGCA
GCTAAACGGCCTGGAAAACATCACCCTGCCGGCGGGGATATCGCATTTCACGCTTGAGGTGGTGTTCAGC
GAGGTCTGGCAAAGCGATTTGCCCGTCAGCGCAAGCAGCCTGCGCCTGCACTGTGTGCCGGTGATTAACC
TGTTTACCCTCGAGGCCGATCCGTTGACCATCAGCGGGCTGGAGAGCGAATACCTCCTGCGTCCGAAGCG
CATGCAGGACGGGCATACCGAAATCTATTCTGTCGACAGCGTGACCGGCTCCGGGCGCACCGGGGAGGCA
CGCTATGTGCCTTTCACCCGCTTTCGTCACCAGGGGGGAATGATGCGTCGCCATGCGCCGGAGCGCTACT
ACCACACCCGCGTCAAACGGGGCGTCACCGGCATGCACGATACCTGGCTTATCCTCGGCGGACAGCAATG
GGAGTCTGACCGGGCGCTGGCGCGGGAAACGGTCTCCTTGCGCATCACCGGCACTAACGGCCAGCTGCCG
CGCCGGGCGCTACAGAGCACGCTGCTGGATCGCTGTGAGTCGATATCAGCCACGCCGCTTACCGTCCGCA
ATCTCTGTAAGCCCACATTGCCGGTATATCCCCCGGCGGAAGACCGCTACCACTGGCGGGTCATGAGCCA
TCTGGGCACCCGTTTTCTCAATATGATGAGCAGCGCCGAGGTACTGCGCGGTACGCTGTCGCTCTACAAC
TGGCGGGAGGATGAGCTCAATAATCGCCGTCTGGACGCTATTCTGGCGGTCAGCCATCACCGAATTCAGC
GTTTCGAGCAGGGTTTCCTGCTGCGCGGGCTGGATATCGAAGTGACGCTCGACGGTAGCGGATTTACCGG
TGCGGGCGATGTCCACCTGTTTGGCGACATGCTCAACCGCTTTTTCGCACTGTATGCCGATATGAATCAG
TTCAACCAGCTGACGCTCATTGTTCAACCTGAAGGGAAATGTATCCGGTGGAAAGAGAATCACAGTCTGC
GCCTGCCCGGCTGA
 Primer design