SecReT6
Protein ID: 206578686
SecReT6 ID305
T6SS typeN/A
Gene symbol-
Locus tagKPK_2046
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]2107781..2110408 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB5XW28
KEGG IDkpe:KPK_2046
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.30E-63, Aligned region: 35..355
Phage_GPD [PF05954], Evalue: 4.30E-63, Aligned region: 567..608
DUF2345 [PF10106], Evalue: 3.00E-42, Aligned region: 609..761
T6SS_Vgr [PF13296], Evalue: 1.50E-35, Aligned region: 487..593
T6SS_Vgr [PF13296], Evalue: 1.50E-35, Aligned region: 628..653
Phage_base_V [PF04717], Evalue: 1.60E-15, Aligned region: 387..482
Protein Sequence: 875 a.a.     [Download]
>gi|206578686|ref|YP_002237885.1| unnamed protein product [Klebsiella pneumoniae 342]
MDTFSMITGTTLNRYQLDIPSCTASLDVEEFSGAEKLSELYYYTITFTSAEKNIDAAQLLSKPAMLTMGG
GALQQLADCKRVHGVITTFRRVNRSEDQSTYQITLQPFLFLLDKQFRSHRFFVNKSVPEVVEQVLQEHHL
HDWEYEFNLKQHYPRREQINQYQESDLAFIQRLLAEVGIFYFFTLQEEAQSEVVHFADAQRALMFDKTLP
VNSPSGMSDSGAESIWGLNITHNVVEANVTTRDYNPRDAQSVLQSATADMTRGNGEGLTYGEVYHYKLRH
RERGDKIDPQTETANFYARLDHERFLAHQTLITASSTAAWLAPAQVLTVTDSLPSTLPAPVQDPLLITGT
GFTASRREALRVTLLAVPYSETLCWRPPLLPRPKVTGTMTARVTSAKANDIYAWQDASGLYRVKFDADRE
DKGQGQESMPVRLAKPYGGDVYGFHFPLIQGTEVAIAFHEGDPDRPYIAHALHDSRHVDPVTEKNSTRNV
IRTPANNKLRMEDKRGEEHIKLSTEYGGKTQLNLGHNVDASRKLRGEGFELRTDSWGGIRAGKGIFITAD
SQTEAQGKVLDMAAVHSLLTQAVSQMESLSQAASAAKAQLLQYEQQQALMEEKLLALKQAVLLMSAPEGI
ALASGSHLQAVASENIYMTAGQNVELGAKKNITLAASEKISIFTETEGIEAIVAKGDLISQAQSGNIEVI
AKQNISLTSTTEGMTFTAAKTLTFTCAGGAYIRLSGGNIELGCPGDIMMKQSKLLYSGPASMQSNIPELP
DSGPQSMSFMLLDALGNAAPSTMKVSLFDSKSKEQIWSSAFNDGGSGCFEPPESENFHAIIGDDKWTSLF
SYNDEHDIEDETDDDLDFDEHGPQYDGELNEQDKE
 
Nucleotide Sequence: 2628 bp     [Download]
>gi|206575712|ref|NC_011283.1|:2107781-2110408 Klebsiella pneumoniae 342 chromosome, complete genome
ATGGATACCTTTTCAATGATTACCGGCACCACCCTTAACCGTTACCAGCTGGATATTCCTTCATGTACCG
CATCGCTGGATGTGGAAGAATTCAGTGGTGCAGAAAAGCTGAGTGAACTTTATTATTACACCATTACGTT
TACCAGCGCAGAGAAAAACATCGATGCCGCACAGCTCCTGAGCAAACCCGCCATGCTGACGATGGGCGGC
GGCGCACTGCAGCAGCTGGCGGACTGCAAACGCGTCCATGGTGTGATTACCACCTTCCGGCGCGTCAATC
GTTCTGAAGATCAGTCGACCTATCAGATAACCCTCCAGCCGTTTCTCTTCCTGCTGGATAAACAGTTTCG
CAGCCATCGTTTTTTCGTGAATAAATCGGTACCGGAGGTGGTGGAGCAGGTATTGCAGGAACATCACCTG
CATGACTGGGAGTATGAGTTTAATCTCAAGCAACACTATCCGCGGCGCGAGCAAATTAATCAGTATCAGG
AGAGCGACCTGGCATTTATCCAGCGCCTGCTGGCAGAGGTGGGGATATTTTATTTCTTCACCTTGCAGGA
AGAGGCCCAGAGCGAAGTGGTCCACTTCGCCGACGCGCAGCGGGCGCTGATGTTCGATAAAACACTCCCT
GTAAACAGCCCGTCAGGGATGAGCGACAGCGGTGCGGAATCGATATGGGGTCTGAACATCACCCACAACG
TCGTAGAGGCGAACGTTACTACCCGGGATTATAACCCCCGCGATGCGCAGAGCGTTCTCCAGTCGGCAAC
AGCGGATATGACCCGGGGAAATGGGGAAGGCCTCACTTACGGTGAGGTATACCACTATAAGCTTCGTCAC
CGGGAGCGTGGCGATAAAATCGACCCGCAGACGGAGACCGCCAACTTTTATGCCCGTCTCGACCATGAGC
GTTTTCTGGCTCACCAGACGCTTATTACCGCGAGCAGTACTGCAGCCTGGCTGGCGCCGGCCCAGGTGCT
GACCGTTACCGACAGCCTGCCATCGACCCTGCCTGCGCCCGTGCAGGATCCGCTGTTAATCACCGGCACC
GGCTTTACCGCCAGCCGCCGGGAGGCGCTGCGGGTGACCCTGCTGGCGGTGCCCTACAGCGAAACATTGT
GCTGGCGTCCGCCGCTGCTGCCGCGCCCGAAGGTGACTGGCACCATGACGGCACGGGTGACCAGCGCGAA
AGCGAATGATATCTACGCCTGGCAGGATGCGTCCGGCCTGTATCGGGTGAAATTTGACGCTGACAGAGAG
GATAAAGGGCAGGGTCAGGAAAGCATGCCGGTGCGTCTCGCCAAACCCTACGGCGGCGACGTGTACGGCT
TTCACTTCCCGCTGATCCAGGGCACGGAGGTGGCGATTGCTTTCCACGAAGGCGACCCTGACCGGCCGTA
TATTGCGCATGCGCTGCACGACTCGCGGCATGTCGACCCTGTGACGGAGAAAAACAGCACCCGCAATGTG
ATTCGTACTCCGGCCAATAATAAGCTGCGAATGGAGGATAAGCGCGGCGAGGAGCATATCAAGCTCAGCA
CCGAGTACGGCGGCAAGACGCAGCTGAATTTAGGACATAACGTTGATGCCAGCCGCAAGCTTAGGGGGGA
AGGGTTTGAACTGCGTACCGATTCGTGGGGAGGGATCCGGGCAGGGAAAGGGATATTCATTACTGCGGAC
AGCCAGACTGAGGCACAAGGGAAAGTGCTGGATATGGCTGCGGTACATTCCTTGTTGACGCAAGCCGTTA
GTCAAATGGAGTCTCTTTCACAGGCAGCATCAGCAGCAAAAGCACAGCTCTTGCAATATGAGCAACAACA
GGCACTGATGGAAGAGAAGTTACTTGCGCTAAAGCAGGCTGTATTACTGATGAGTGCACCAGAAGGTATT
GCTTTAGCCAGTGGAAGTCATCTTCAGGCAGTTGCAAGCGAAAATATTTATATGACTGCAGGGCAAAATG
TTGAACTGGGAGCAAAGAAAAATATTACTCTTGCCGCTTCTGAAAAAATATCAATCTTTACCGAAACTGA
GGGCATAGAAGCTATTGTAGCCAAAGGCGATCTAATATCACAGGCTCAGTCAGGAAATATTGAAGTAATA
GCTAAGCAAAATATTTCGCTGACCAGTACAACAGAGGGTATGACTTTTACAGCGGCAAAAACTTTAACGT
TTACCTGTGCTGGCGGGGCATACATTCGCCTGTCCGGAGGAAACATCGAGTTAGGCTGCCCTGGTGATAT
TATGATGAAGCAAAGTAAGCTTCTCTACAGTGGCCCAGCTTCTATGCAGTCAAATATTCCAGAACTTCCT
GATAGTGGTCCACAGTCAATGAGTTTTATGCTCTTAGATGCTCTTGGTAATGCTGCGCCATCTACTATGA
AAGTGAGTCTTTTTGATAGTAAATCAAAAGAACAAATATGGAGTTCTGCTTTTAATGATGGAGGGTCAGG
TTGTTTTGAACCGCCTGAAAGTGAAAATTTTCATGCAATAATTGGCGATGATAAATGGACGAGCCTTTTT
TCTTATAACGATGAGCATGATATTGAGGATGAGACTGATGATGACCTGGATTTCGATGAACATGGTCCGC
AATATGATGGTGAATTAAACGAACAAGATAAGGAATAG
 Primer design