SecReT6
Protein ID: 206578921
SecReT6 ID305
T6SS typeN/A
Gene symbol-
Locus tagKPK_2055
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]2122205..2122741 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDB5XW37
KEGG IDkpe:KPK_2055
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.50E-38, Aligned region: 19..169
Protein Sequence: 178 a.a.     [Download]
>gi|206578921|ref|YP_002237894.1| unnamed protein product [Klebsiella pneumoniae 342]
MAITADKPSARLLAFLMVTVLTGCGLTQTVKDGAVSVTQSIFYPQVKTLHLDLRAREGVNNNAKGASLAM
VVRIYQLKDRQAFDNTDYPSLFAGDGQALQADRVAEKDVRLRPGESVTVDMPMETSAQFVAVAAMFIDPD
LTQNSWRLVLTRDDLDPARPRIIEASQNQLTLHPLKEK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|206575712|ref|NC_011283.1|:2122205-2122741 Klebsiella pneumoniae 342 chromosome, complete genome
ATGGCGATTACCGCAGATAAACCCTCCGCCAGGTTGCTGGCATTCCTTATGGTTACCGTCTTAACCGGCT
GCGGCCTGACGCAGACCGTGAAAGACGGCGCCGTTTCCGTGACCCAGTCCATTTTTTACCCCCAGGTGAA
AACCCTGCATCTGGATCTTCGCGCCCGGGAAGGCGTGAATAACAACGCCAAAGGCGCCTCCCTGGCGATG
GTGGTGCGTATTTACCAGCTTAAGGATCGGCAGGCGTTTGACAATACTGACTACCCGTCGCTGTTTGCTG
GCGATGGCCAGGCGCTGCAGGCGGACCGGGTGGCGGAAAAAGATGTTCGCCTGCGTCCGGGCGAATCGGT
GACCGTCGATATGCCTATGGAAACCAGCGCGCAGTTTGTGGCGGTGGCGGCCATGTTTATCGATCCAGAC
CTGACGCAAAACAGCTGGCGGCTGGTACTCACCCGGGACGATCTTGACCCGGCGAGGCCGCGCATTATCG
AAGCCAGCCAAAATCAACTGACGTTGCACCCGCTTAAGGAGAAGTGA
 Primer design