SecReT6
Protein ID: 206579221
SecReT6 ID305
T6SS typeN/A
Gene symbol-
Locus tagKPK_2052
StrainKlebsiella pneumoniae 342
Repliconchromosome [GenBank: NC_011283] [Browse all T6SS(s) in this replicon]
Location [Strand]2116315..2119281 [+]
ProductImcF-related family protein
NoteTssM
UniProt IDB5XW34
KEGG IDkpe:KPK_2052
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 7.40E-77, Aligned region: 239..259
IcmF-related [PF06761], Evalue: 7.40E-77, Aligned region: 268..586
DUF1215 [PF06744], Evalue: 1.20E-34, Aligned region: 485..504
DUF1215 [PF06744], Evalue: 1.20E-34, Aligned region: 707..825
Protein Sequence: 988 a.a.     [Download]
>gi|206579221|ref|YP_002237891.1| unnamed protein product [Klebsiella pneumoniae 342]
MLLWGGDPATPADADWLAVLRKLRRRAVDGMVWVTSALDGLPATENSATSGLTPDAMDSVSHALKLRYEA
LGWKLPLYVWSLHPRAGEQAGRVTQPVGCLLPANCSPQTLAGQLTGLIPQLTAQGIQQVCGQPQHNFLLA
LADQLTRKPETVTEPLSVLLNPYRPQPLAGVVFSAPSAEAGRSISHHWGRDNRWDILPDRMTELPAGLRP
RKQGVNWMRGMSVATAALMLLWAASMTVSFIANRELVATAQQQVQQASAGKQPLAVRLHALSALQKTLSQ
LEYRSQHGAPWYFRAGLSQNDDLLAALFPRYGERAQPLLRDAAARHLEEQLTAFVQLPPDSPLREKMTKT
AYGQLKQYLMLTRPEKMDAAWFATTLMQDWSQRSGIADAVWQGSGPSLLAFYAASLASHPQWRLPVDDGL
VSQVRTRLIRQLGQRNSESTLYQKMLAQVANQYADMRLADMTADTDASRLFSTDEVVPGMFTRQAWEQAV
QPAIEKVVAERRDEMDWVLSDTKQPAAQSTSPEALRARLAERYFADFSGAWLDFLNSLRWQRAATLSDAI
DQLTLMADVRQSPLVALMNTLSVQGRTGQTGEAIADSLVKSARQLFNRDNPPVIDQRSGARGPLDATFGP
VLALLDNRDGGTPTSRLSLQTFLTRVTQVRLRLQQVTNATDPQAMTRLLAQTVFQGKAVDLTETRDYGSL
VAAGLGQQWSGFGQTLFVRPMEQAWQQVLTPAAESLNAQWRSAVVEDWNSAFGGRYPFKNTSSEVSLPLL
AKYLNSETGRIARFLQTRLNGVLHKEGSRWMADSINAQGLTFNPAFLQAMNTLSHLSDVAFANGEAGLHF
ALRPGTADGVMQTELVIDSQKLVYMNQMPAWRRFSWPADTEAPGASLSWISTRAGTRQYGDFPGAWGWIR
LLDKAVVSAYPGTSSSWSLSWKAPDGLLLNYTLRTEAGEGPLALLALRNFTLPETIFSARAPAERVPLTD
DIPGEEGY
 
Nucleotide Sequence: 2967 bp     [Download]
>gi|206575712|ref|NC_011283.1|:2116315-2119281 Klebsiella pneumoniae 342 chromosome, complete genome
GTGCTGCTGTGGGGTGGCGATCCTGCGACTCCGGCCGATGCAGACTGGCTGGCTGTGTTGCGTAAACTGC
GCCGCCGTGCGGTGGACGGAATGGTCTGGGTGACCTCAGCGCTGGACGGTCTGCCGGCAACGGAAAACAG
CGCAACCTCAGGTCTCACGCCAGATGCAATGGATAGCGTGTCTCATGCTTTAAAGCTTCGCTATGAGGCT
CTGGGCTGGAAGCTGCCACTGTACGTCTGGTCGCTGCATCCGCGCGCCGGAGAACAGGCCGGGCGCGTCA
CCCAGCCAGTGGGGTGCCTGTTGCCTGCGAATTGTTCACCGCAGACGCTCGCCGGACAGCTTACCGGGCT
GATACCGCAGCTGACCGCGCAAGGCATACAGCAGGTCTGCGGTCAGCCACAGCACAATTTTTTACTCGCG
CTGGCCGATCAGTTGACCCGTAAACCGGAAACGGTGACGGAGCCGTTATCGGTATTGCTTAATCCTTACC
GCCCGCAGCCGCTGGCCGGAGTGGTGTTCAGCGCGCCGTCGGCGGAGGCCGGCCGCAGCATCAGCCATCA
CTGGGGCCGGGATAACCGCTGGGATATTCTGCCGGACAGGATGACGGAATTACCCGCAGGTCTACGTCCG
CGCAAACAGGGAGTCAACTGGATGCGTGGGATGAGCGTGGCCACTGCCGCCCTGATGTTACTCTGGGCCG
CCTCAATGACAGTCTCTTTTATCGCCAACCGCGAGCTGGTGGCGACCGCACAGCAGCAGGTGCAGCAGGC
CTCGGCGGGAAAACAACCGCTGGCCGTACGCCTGCATGCGCTCTCCGCGTTACAGAAAACGCTTTCTCAA
CTGGAATACCGCTCGCAGCACGGCGCGCCGTGGTACTTCCGCGCTGGCCTCAGTCAGAACGATGACCTGC
TGGCGGCGCTGTTTCCGCGCTACGGAGAGAGGGCGCAGCCGCTGCTGCGCGATGCGGCGGCGCGTCATCT
GGAAGAGCAGCTCACCGCCTTCGTACAGCTGCCGCCGGACAGCCCGCTGCGTGAGAAGATGACGAAGACC
GCTTACGGACAACTGAAACAATATCTGATGTTGACCCGCCCGGAAAAAATGGACGCCGCGTGGTTCGCTA
CCACGCTAATGCAGGACTGGTCGCAGCGCTCAGGCATCGCCGACGCCGTCTGGCAGGGTAGCGGCCCTTC
GCTGCTGGCATTTTACGCCGCCAGTCTGGCGTCGCATCCGCAGTGGCGTCTGCCTGTCGATGACGGTCTG
GTCAGCCAGGTGCGCACACGGTTAATTCGCCAACTGGGCCAGCGCAACAGTGAGTCCACGCTTTACCAGA
AGATGCTCGCGCAGGTGGCGAATCAGTATGCCGATATGCGCCTGGCGGATATGACTGCCGACACCGATGC
TTCGCGTCTGTTCAGCACTGATGAGGTGGTGCCGGGAATGTTTACCCGTCAGGCCTGGGAGCAGGCCGTG
CAGCCGGCCATTGAGAAAGTGGTCGCGGAACGCCGCGATGAAATGGACTGGGTGCTGAGCGACACGAAGC
AGCCTGCCGCGCAGTCGACGTCGCCGGAAGCCTTGCGAGCCCGGCTGGCGGAGCGTTATTTCGCTGATTT
CAGCGGCGCCTGGCTGGATTTTCTCAACAGCTTGCGCTGGCAGCGCGCGGCGACCCTCTCTGATGCCATT
GACCAACTGACCCTGATGGCCGATGTGCGCCAGTCGCCGCTGGTGGCGCTGATGAACACCCTGAGCGTGC
AGGGGCGAACCGGCCAGACCGGGGAAGCCATCGCCGATTCGCTGGTCAAATCGGCCAGGCAGCTGTTCAA
CCGTGACAACCCACCCGTCATCGATCAACGGTCCGGCGCGCGCGGTCCTCTGGATGCCACCTTCGGCCCC
GTACTGGCGCTGCTGGACAATCGCGACGGCGGGACGCCCACCAGCCGTCTTAGCCTGCAGACCTTCCTGA
CCCGCGTCACCCAGGTGCGTCTGCGCCTGCAGCAGGTCACCAACGCCACCGACCCGCAGGCGATGACCCG
CCTGCTTGCGCAGACGGTGTTCCAGGGCAAGGCCGTGGATTTAACCGAAACGCGCGACTACGGCAGCCTG
GTGGCGGCGGGACTGGGCCAGCAGTGGAGTGGTTTTGGGCAGACGCTGTTTGTTCGCCCGATGGAGCAGG
CCTGGCAGCAGGTGCTGACCCCGGCGGCGGAAAGTCTCAACGCCCAGTGGCGCAGCGCGGTGGTGGAGGA
CTGGAATAGCGCTTTTGGCGGTCGCTACCCCTTTAAAAATACCAGCAGTGAAGTCTCTCTGCCGCTGCTG
GCAAAATATCTTAATAGCGAGACCGGGCGCATCGCCCGCTTTCTGCAGACCCGGCTGAACGGTGTGCTGC
ATAAAGAGGGGAGCCGCTGGATGGCGGACAGTATCAATGCTCAGGGACTGACATTTAACCCGGCCTTTCT
GCAGGCGATGAATACCCTGAGCCATCTCTCCGACGTCGCGTTCGCCAACGGCGAAGCGGGATTGCATTTT
GCGCTACGCCCCGGCACGGCGGACGGCGTGATGCAGACGGAGCTGGTCATCGACAGTCAGAAACTTGTCT
ATATGAACCAGATGCCGGCCTGGCGGCGGTTCAGCTGGCCCGCCGACACCGAAGCGCCGGGCGCTAGTCT
GAGCTGGATCAGTACCCGGGCGGGCACCCGCCAGTATGGCGATTTCCCGGGCGCCTGGGGGTGGATCCGA
CTGCTGGATAAGGCGGTAGTCAGCGCTTATCCCGGAACGAGCAGCAGCTGGAGCCTGAGCTGGAAAGCGC
CGGATGGTTTGTTGCTGAACTACACCCTGCGTACCGAGGCGGGGGAAGGACCGCTGGCGCTGTTGGCCCT
GCGAAACTTTACGCTACCGGAGACGATATTCAGCGCGCGCGCGCCTGCTGAGCGTGTTCCGCTGACCGAC
GATATACCCGGCGAAGAGGGATACTGA
 Primer design