SecReT6
Protein ID: 21244836
SecReT6 ID27
T6SS typeN/A
Gene symbol-
Locus tagXAC4119
StrainXanthomonas axonopodis pv. citri str. 306
Repliconchromosome [GenBank: NC_003919] [Browse all T6SS(s) in this replicon]
Location [Strand]4833998..4837528 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ8PF66
KEGG IDxac:XAC4119
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.40E-90, Aligned region: 191..453
ImcF-related_N [PF14331], Evalue: 8.40E-90, Aligned region: 889..940
IcmF-related [PF06761], Evalue: 6.90E-69, Aligned region: 504..802
DUF1215 [PF06744], Evalue: 2.30E-28, Aligned region: 918..1040
AAA_22 [PF13401], Evalue: 2.40E-05, Aligned region: 129..266
AAA_22 [PF13401], Evalue: 2.40E-05, Aligned region: 435..483
AAA_16 [PF13191], Evalue: 0.008, Aligned region: 120..244
AAA_16 [PF13191], Evalue: 0.008, Aligned region: 574..589
AAA_16 [PF13191], Evalue: 0.008, Aligned region: 780..894
AAA_16 [PF13191], Evalue: 0.008, Aligned region: 878..946
Protein Sequence: 1176 a.a.     [Download]
>gi|21244836|ref|NP_644418.1| unnamed protein product [Xanthomonas axonopodis pv. citri str. 306]
MTMKTLLSKLSATVVVGLLALCLLSVLLWVGGPYVALAGWSPLSSVAARLLAIVLLLVVWVGVLALRRWR
RQARAATLSSALAAPGRDDDRELRSGQERAQLQARFQQAIQLLRKRRGGADLYTLPWYALIGPPGSGKST
LLQHSGLQFPLAARMGDAALRGVGGTRDCEWWFTDEAVFLDTAGRYTTQDSDQAVDAGAWRDFLRLLRRY
RPRRPLNGVLVTMSMSDLLLLDDAERDTHMQAIRRRLDELAEQLQASVPVYLIFTKCDLIGGFGEFFDDL
TPAQRNQVWGMTFALAQTLDGHAARKFADEFGVLQQQLSARLFERLNLERDRLRCAAILSFPQQVAALGE
RARQFVEGTFAGNAYGPAPLLRGVYFTSGTQDGTPIDRMMGAVARTFGLEEARVQAPGAQRRTFFVERLL
REVVLRESGLANAPPAQQRRRAWLQAAAYAGVALLTGAALAGLGLSYLGNRAYLQQVRAALEARPAVPDP
HAATGMPEYVARTLQQADATQAVVKVAQQYHAGAPWSLRMGLFQGQALGEQVRAGYLRQLNATLLPALAV
RLRTGLVDNAQAPQALYYTLKGYLMLGQPQHLDPAQLSALAAIEAEKLFPGEPALQQALSAHLQAVLESP
THVRALSLDNQRIAQARASLRAADLSTLIYGNLLLTPPDGTPLRLDKALGLLADTFVRRSGTALSMPVPA
LYTQPVFAALQREGIGQAVERFGRDDWVFGGAALDASARATLVREVGQRYTADYIRYWDGLLADLQLRPS
ADLAGASATAAKLAGPSSPLRLLLGVVGEHTQAMDRAPPADPAQRALAAAASSAGAKANAAAAKLPGGAA
ISAALATPADGAAAAAPAPGAAISEHFLALNALAAGAPGSTPLDHLLSVLDQLGKQLLVISQGGGDAAAA
NAQLALARQEMAQLPPPVTDWLQSLAGSSATLMTQGARAALDAQVRQSVGEVCTDFVRGRYPFDPEAQVE
IPLQNFGELFGSGGRLETLYTGTVKPLLDTQSPQWRWKDGPDAVIGAPGLPVQLQLAQRIRQKYFRGGPT
PQIGFTVLAPTLGEGVTRLTLDIEGQRYDYQPGAAQSMPMIWPGPVPGHVSIAAFGADGVALGTLDYQGD
WALFRALQAGHLENPSDLRFVASFALGGHDVQVPLRAGNLRHPFLDRDVQHFACGG
 
Nucleotide Sequence: 3531 bp     [Download]
>gi|21240774|ref|NC_003919.1|:c4837528-4833998 Xanthomonas axonopodis pv. citri str. 306 chromosome, complete genome
ATGACGATGAAGACGCTGTTGTCCAAGCTGAGCGCAACGGTGGTGGTCGGCCTGTTGGCGCTGTGCCTGC
TGTCGGTGTTGCTGTGGGTGGGTGGGCCGTATGTGGCGCTGGCCGGCTGGAGCCCGCTGAGCAGCGTGGC
GGCGCGGTTGCTGGCGATCGTGTTGCTGCTGGTGGTGTGGGTGGGTGTGCTGGCGCTGCGCCGCTGGCGC
AGGCAGGCGCGTGCGGCGACCTTGTCCAGCGCCCTGGCGGCGCCCGGCCGCGACGACGACCGCGAGCTGC
GCAGCGGACAGGAACGCGCGCAGCTGCAGGCGCGCTTTCAGCAGGCGATCCAGCTGCTACGCAAGCGGCG
CGGCGGCGCCGATCTGTATACGCTGCCGTGGTATGCGCTGATCGGCCCGCCCGGTTCGGGCAAGAGCACC
TTGCTGCAGCATTCGGGCCTGCAGTTTCCGCTGGCTGCGCGCATGGGCGATGCGGCGTTGCGCGGCGTCG
GCGGCACCCGCGATTGCGAATGGTGGTTCACCGACGAAGCGGTGTTCCTGGACACCGCCGGGCGCTACAC
CACGCAGGATTCGGATCAGGCGGTGGATGCCGGCGCGTGGCGCGATTTCCTGCGCCTGCTGCGACGCTAT
CGCCCACGCCGCCCGCTCAACGGCGTGTTGGTGACGATGAGCATGTCGGACCTGTTGCTGCTCGACGATG
CCGAGCGCGACACGCATATGCAGGCGATCCGCCGCCGCCTGGACGAGCTGGCCGAGCAGTTGCAGGCCAG
CGTGCCGGTGTATCTGATCTTCACCAAGTGCGATCTGATCGGCGGCTTCGGCGAGTTCTTCGACGATCTG
ACGCCGGCGCAGCGCAACCAGGTGTGGGGCATGACATTTGCGCTGGCGCAGACCCTGGACGGGCACGCGG
CGCGCAAGTTCGCCGACGAGTTCGGCGTGCTGCAGCAGCAGCTGAGCGCGCGCCTGTTCGAACGCCTGAA
CCTGGAGCGCGACCGTCTGCGGTGTGCGGCGATCCTGTCGTTTCCGCAACAGGTTGCCGCTCTTGGCGAG
CGTGCACGGCAATTTGTCGAAGGCACGTTCGCCGGCAATGCGTATGGCCCGGCACCGCTGCTGCGCGGGG
TGTACTTCACCTCCGGCACCCAGGACGGCACGCCGATCGACCGCATGATGGGCGCGGTGGCGCGCACCTT
CGGCCTGGAAGAAGCGCGCGTGCAGGCACCGGGCGCGCAACGCCGCACCTTCTTCGTCGAGCGGCTGCTG
CGCGAGGTGGTGCTGCGCGAATCCGGCCTGGCCAATGCTCCGCCCGCCCAGCAGCGCCGCAGGGCGTGGT
TGCAGGCCGCCGCGTACGCGGGTGTGGCGTTGCTGACCGGCGCCGCGCTGGCCGGGTTGGGGCTCAGCTA
CCTGGGCAACCGTGCGTACCTGCAGCAGGTACGTGCTGCACTGGAGGCGCGGCCGGCAGTGCCCGATCCC
CATGCCGCCACCGGCATGCCCGAGTACGTCGCGCGCACCCTGCAGCAAGCCGATGCGACGCAGGCGGTGG
TGAAGGTGGCGCAGCAGTATCACGCCGGCGCGCCGTGGTCGTTGCGCATGGGATTGTTCCAGGGACAGGC
GTTGGGCGAGCAAGTGCGGGCGGGCTATCTGCGTCAGCTCAACGCCACCTTGTTGCCGGCCTTGGCGGTG
CGCCTGCGCACCGGTCTGGTGGATAACGCGCAGGCGCCGCAGGCGCTGTACTACACGCTCAAGGGCTATC
TGATGCTGGGCCAGCCGCAGCATCTGGACCCGGCGCAACTCAGCGCGCTGGCGGCGATCGAAGCCGAAAA
ATTATTCCCGGGCGAGCCGGCCTTGCAGCAGGCGCTGAGTGCGCATCTGCAGGCGGTGCTGGAGTCGCCC
ACGCACGTGCGTGCGCTGTCGCTGGACAACCAACGCATCGCCCAGGCACGTGCCAGCCTGCGTGCCGCCG
ATCTGTCGACACTGATCTACGGCAACCTGTTGCTGACCCCGCCGGACGGCACGCCGTTGCGGCTGGACAA
AGCGCTGGGCCTGCTGGCCGACACCTTCGTGCGCCGCAGTGGCACGGCGTTGTCCATGCCGGTGCCGGCG
CTGTACACACAGCCGGTGTTCGCCGCCCTGCAACGCGAGGGCATCGGCCAGGCGGTGGAACGCTTCGGCC
GCGACGATTGGGTCTTCGGCGGTGCGGCGCTGGATGCGTCTGCCAGGGCCACGCTGGTGCGCGAAGTGGG
GCAGCGCTACACGGCCGACTACATCCGTTACTGGGATGGACTGCTGGCCGATCTGCAACTGCGCCCCTCG
GCCGATCTGGCCGGTGCCAGCGCCACTGCCGCCAAGCTGGCCGGGCCCAGTTCGCCCCTGCGGCTGCTGC
TGGGCGTGGTGGGCGAGCACACCCAGGCGATGGACCGCGCACCGCCGGCAGACCCCGCGCAACGCGCGCT
GGCGGCTGCCGCCAGCTCGGCAGGCGCCAAGGCGAATGCGGCCGCGGCCAAACTCCCCGGCGGGGCGGCG
ATCAGCGCCGCGCTGGCCACGCCCGCCGATGGTGCCGCAGCTGCGGCGCCGGCACCGGGTGCGGCGATCA
GCGAGCATTTTCTGGCGCTCAACGCCTTGGCCGCCGGCGCGCCCGGCAGCACGCCGCTGGACCATCTGCT
GAGCGTGCTCGATCAGCTCGGCAAGCAATTGCTGGTGATCTCCCAGGGCGGCGGCGATGCCGCGGCGGCC
AACGCGCAACTGGCATTGGCCCGGCAGGAAATGGCGCAACTGCCACCGCCGGTGACCGACTGGCTGCAGA
GCCTGGCCGGCAGCAGCGCCACCTTGATGACCCAGGGTGCACGCGCCGCACTGGATGCGCAGGTCAGGCA
ATCGGTGGGCGAGGTGTGCACGGATTTCGTGCGTGGCCGCTACCCGTTCGATCCGGAGGCGCAGGTGGAG
ATTCCGCTGCAGAATTTCGGCGAGTTGTTCGGCAGTGGTGGGCGTCTGGAGACGCTCTACACCGGCACCG
TCAAACCGCTGCTGGACACCCAGTCCCCGCAATGGCGCTGGAAGGATGGCCCGGACGCGGTCATCGGCGC
ACCCGGTCTGCCGGTGCAACTGCAGTTGGCGCAACGGATCCGGCAGAAATATTTTCGCGGCGGGCCCACG
CCGCAGATCGGCTTTACCGTGCTGGCGCCCACGCTGGGCGAGGGCGTGACCCGGCTGACGCTGGATATCG
AAGGCCAGCGTTACGACTACCAGCCCGGCGCGGCGCAAAGCATGCCGATGATCTGGCCCGGCCCGGTGCC
GGGGCATGTTTCCATCGCCGCGTTCGGCGCCGATGGCGTGGCGCTGGGAACGCTCGACTACCAGGGCGAC
TGGGCGCTGTTCCGTGCGCTGCAGGCCGGGCACCTGGAAAACCCATCGGATCTGCGCTTTGTCGCCAGCT
TCGCGCTTGGCGGCCACGACGTGCAGGTGCCGCTGCGTGCCGGCAACCTGCGCCACCCGTTTCTGGACCG
CGACGTCCAGCACTTCGCGTGCGGCGGATGA
 Primer design