SecReT6
Protein ID: 217978497
SecReT6 ID313
T6SS typei3
Gene symbol-
Locus tagMsil_2352
StrainMethylocella silvestris BL2
Repliconchromosome [GenBank: NC_011666] [Browse all T6SS(s) in this replicon]
Location [Strand]2556793..2560338 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB8EIG3
KEGG IDmsl:Msil_2352
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.60E-88, Aligned region: 182..441
IcmF-related [PF06761], Evalue: 3.10E-79, Aligned region: 495..804
DUF1215 [PF06744], Evalue: 7.90E-30, Aligned region: 891..1016
Protein Sequence: 1181 a.a.     [Download]
>gi|217978497|ref|YP_002362644.1| type VI secretion protein IcmF [Methylocella silvestris BL2]
MNKEIIRIIAYGVGLSSIAAVVYLAGPMIEIGGVRPLENSIVRDIIIVVLVAAAAGLAGFTFWRRKKNAA
EIEKGIAEGGAPDSDAEVLGERMKDALATLKNASKGATKGAYLYELPWYLLIGPPGAGKTTALANSGLKF
PLSRGATPAAVAGVGGTRYCDWWFTEDAVMIDTAGRYTTQDSDARADQKSWLAFLDLLKKNRPRQPINGV
IVAIALSDIMTETQAQIEAHAQAIRSRLIEVNKQLKVDFPVYVLFTKADLISGFREFFGSLNENARAQVW
GATFQTADKKLNLVGEVPAEYDSLIARLNEWTTDRLQEEPVPSTRASLFGFPAQVAALKKPVFNFLNLIF
EPTRYHANATLRGFYFTSGTQEGTPIDQLIGALSRSFGAREVAANAYSGRGQSYFLKNLVGKLIIGEAAW
VSTDRAAVFRARLIKGVALGLLALVCAGLSLAWFGSYQRNSDLIVRTQAGAADFRTVAGPLATEPEISDR
DLAKILPPLNKLRFLPAGFETKGETPPLAATFGLSQFDRLQSASTGAYDMALERLLRPRLIYRLEEQMEA
NRGDPSFLYEALKVYLMLGGLHAVDRDLVMNYLRRDWTENLYPGSANADGRRLLEAHVAAMLDMKGDIIV
SLNGPLVSEAQNLLARLSVSQQAYELLRSQAASSEISDWNAARQGGPDSALVFEATQGAALDSIKVPAFY
TYAGFRRLFIDRLSGIGEKLKSDRWVLGAAGEQAAVEDQYKSLSDDLLAIYGKDFIAAWQSALGRLKLKR
LLADKPKYVTLAAASAPTSPIKQLIVSVRDETALTRERPGFAKKEGVDPNAALFQNRAVPGADIEQAFKA
YHVLVEGEAGRAPVDLIISNLAEIYQSLLLMGNPAQAPLATSQLQTQVAALRANANRLPQPFAGMLQTAG
TDIDGDLTNSFRSQLNRALRDTVTGVCQQVVSNRYPFARTDREVSLVDFGRLFGPQGIIDKFFSTQIQQY
VDMSKPVWTFRQDNNVARALASSGATLKEFQRAAQIRDVFFATGGLMPSMTLTITPPPAPLPALPAPPPP
AAGAAQAAPAATPAPAAPTVSIKMDMNGTPIISPAGASAPVVAQWPGASTNRSAITVTSDAPGAQPSTIE
RRGPWSLFRLIEAGAPVPHGDSIVVSYIVGGRELQYTFSAGSTQNPFTLPALREFHCPSDL
 
Nucleotide Sequence: 3546 bp     [Download]
>gi|217976200|ref|NC_011666.1|:c2560338-2556793 Methylocella silvestris BL2 chromosome, complete genome
ATGAACAAGGAAATCATCCGCATCATCGCCTATGGGGTCGGGCTCTCCTCGATCGCCGCGGTGGTCTATC
TCGCCGGTCCGATGATCGAGATCGGCGGCGTTCGCCCGCTCGAAAATTCGATCGTTCGCGACATCATTAT
CGTCGTGCTGGTCGCCGCCGCCGCCGGGCTGGCCGGCTTTACCTTTTGGCGGCGCAAGAAAAACGCTGCC
GAGATCGAAAAGGGCATCGCCGAAGGCGGCGCCCCGGATAGCGACGCCGAGGTTTTGGGCGAGCGCATGA
AGGACGCACTGGCGACGCTGAAAAACGCCAGCAAAGGCGCGACCAAGGGCGCTTATCTTTATGAACTGCC
CTGGTATCTCCTGATCGGACCGCCCGGCGCCGGCAAGACCACGGCGCTCGCCAATTCCGGCCTCAAATTC
CCGCTGAGCCGGGGCGCGACCCCGGCGGCGGTCGCGGGCGTCGGCGGCACGCGCTATTGCGACTGGTGGT
TCACCGAAGACGCCGTGATGATCGACACGGCCGGGCGCTACACGACGCAGGATTCCGACGCGCGGGCCGA
TCAGAAAAGCTGGCTCGCCTTTCTCGATCTTTTGAAGAAGAATCGGCCGCGCCAGCCGATCAATGGCGTC
ATCGTCGCGATCGCCCTCTCCGACATCATGACCGAGACGCAGGCGCAGATCGAAGCGCATGCGCAGGCGA
TTCGCTCGCGGCTGATCGAGGTCAACAAGCAGCTGAAGGTCGATTTTCCGGTCTATGTGCTGTTCACCAA
GGCCGATCTCATCTCGGGCTTTCGCGAGTTTTTCGGCTCGCTCAACGAGAACGCCCGCGCGCAGGTATGG
GGCGCGACCTTCCAGACGGCGGACAAGAAGCTCAATCTCGTCGGCGAGGTTCCGGCCGAATATGATTCGC
TGATCGCGCGCCTCAACGAATGGACCACCGACCGGCTGCAGGAAGAGCCGGTGCCCTCGACGCGCGCGTC
GCTGTTCGGCTTTCCGGCGCAGGTCGCGGCGCTGAAGAAGCCGGTGTTCAATTTCCTCAATCTGATCTTC
GAGCCAACGCGCTACCACGCCAATGCGACGCTGCGCGGCTTCTATTTCACCTCCGGCACGCAGGAGGGCA
CGCCGATCGATCAACTGATCGGCGCGCTCTCGCGCAGTTTTGGCGCGCGCGAAGTCGCCGCCAACGCCTA
TTCGGGGCGAGGCCAGAGCTATTTTCTGAAGAATCTGGTCGGCAAACTGATCATCGGCGAGGCCGCCTGG
GTCTCGACCGACCGCGCCGCGGTGTTTCGCGCGAGGCTGATCAAGGGCGTCGCGCTCGGCCTGCTGGCGC
TCGTCTGCGCGGGCCTCTCGCTCGCCTGGTTCGGCAGCTATCAGCGCAACAGCGATCTGATCGTGCGCAC
GCAGGCTGGCGCGGCCGATTTCCGCACGGTCGCCGGCCCGCTCGCGACGGAGCCCGAAATTTCCGACCGC
GATCTCGCCAAGATTCTGCCCCCGCTCAACAAATTGCGGTTCTTGCCGGCCGGATTTGAAACCAAGGGCG
AGACGCCGCCGCTCGCGGCGACGTTCGGCCTCAGCCAGTTCGACCGGCTGCAATCGGCGTCAACGGGCGC
CTATGACATGGCGCTCGAGCGGCTGCTGCGTCCGCGCCTGATCTACCGTCTCGAAGAGCAGATGGAGGCG
AACCGCGGCGACCCGAGTTTTCTCTATGAGGCGCTGAAGGTCTATCTGATGCTCGGCGGCTTGCATGCGG
TCGATCGTGATCTCGTCATGAATTATCTGCGCCGCGACTGGACCGAAAATCTTTATCCCGGCTCCGCCAA
TGCCGACGGGCGCAGGCTGCTCGAGGCCCATGTCGCGGCGATGCTCGACATGAAGGGCGACATCATCGTC
AGCCTCAACGGGCCGCTGGTGTCGGAAGCGCAAAATCTTCTCGCGCGGCTCAGCGTCTCGCAGCAGGCCT
ATGAGCTGCTCCGCTCGCAGGCGGCAAGCTCGGAGATTTCCGATTGGAACGCCGCGCGGCAGGGCGGCCC
CGATTCTGCGCTGGTGTTCGAGGCGACGCAGGGCGCTGCGCTTGATTCCATAAAGGTGCCGGCCTTCTAC
ACCTATGCCGGCTTCCGCCGTCTGTTCATCGACCGGCTGTCCGGCATCGGCGAAAAACTCAAAAGCGATC
GCTGGGTGCTCGGCGCCGCGGGCGAGCAGGCGGCGGTCGAGGATCAGTACAAAAGCCTCAGCGACGATCT
GCTGGCGATCTATGGCAAGGATTTTATCGCGGCCTGGCAAAGCGCGCTCGGCCGGCTGAAGCTGAAGCGC
CTCCTCGCCGACAAGCCGAAATATGTGACGCTGGCGGCGGCCTCCGCGCCGACTTCGCCAATCAAGCAAC
TGATCGTCTCCGTGCGCGACGAGACCGCGCTGACGCGCGAGCGGCCGGGCTTCGCCAAGAAGGAAGGCGT
CGATCCGAACGCCGCTTTGTTTCAGAACCGCGCCGTCCCGGGCGCCGATATCGAGCAGGCCTTCAAAGCC
TATCACGTGCTGGTCGAGGGGGAGGCCGGGCGGGCGCCGGTCGATCTCATCATCTCGAACCTCGCCGAAA
TCTACCAAAGCCTGCTGCTGATGGGCAATCCGGCGCAGGCTCCGCTCGCAACCTCGCAGCTGCAGACGCA
GGTCGCGGCGTTGCGCGCCAACGCCAACCGGCTGCCGCAGCCCTTCGCCGGCATGCTGCAAACGGCGGGG
ACCGATATCGACGGCGATCTGACCAACAGCTTCCGCTCGCAGCTGAACCGCGCGCTGCGCGATACGGTGA
CGGGGGTCTGCCAGCAGGTGGTGTCGAACCGCTACCCCTTCGCCCGCACCGACCGCGAGGTTTCTCTCGT
CGACTTCGGCCGCCTGTTCGGCCCGCAGGGGATCATCGACAAATTCTTCTCAACTCAGATCCAGCAATAT
GTCGACATGTCGAAGCCGGTCTGGACATTCCGGCAGGACAATAATGTCGCGCGGGCGCTCGCCTCGTCCG
GCGCGACGCTGAAGGAGTTCCAGCGCGCGGCGCAGATCCGCGACGTGTTCTTTGCGACCGGCGGGCTGAT
GCCCTCGATGACGCTGACGATTACGCCGCCGCCGGCGCCGCTTCCCGCTCTGCCTGCTCCGCCGCCGCCC
GCCGCGGGCGCGGCTCAGGCGGCGCCGGCCGCCACTCCGGCGCCCGCCGCGCCGACGGTGAGCATCAAGA
TGGACATGAACGGAACGCCGATCATCAGCCCGGCGGGCGCCTCGGCGCCGGTCGTCGCGCAATGGCCGGG
CGCATCGACCAACCGTAGCGCGATTACCGTGACCTCGGATGCGCCGGGCGCGCAGCCCTCGACCATCGAG
CGGCGCGGTCCCTGGTCGCTGTTCCGGCTGATCGAGGCGGGCGCCCCGGTGCCGCACGGCGATTCGATCG
TCGTCAGCTACATCGTCGGCGGCCGGGAGCTACAATATACGTTCAGCGCGGGCTCGACGCAGAATCCGTT
CACGCTGCCGGCGCTGCGCGAGTTTCACTGCCCGAGCGACCTTTAG
 Primer design