SecReT6
Protein ID: 218549302
SecReT6 ID314
T6SS typei1
Gene symbol-
Locus tagEFER_1964
StrainEscherichia fergusonii ATCC 35469
Repliconchromosome [GenBank: NC_011740] [Browse all T6SS(s) in this replicon]
Location [Strand]2010341..2013862 [-]
ProductIcmF-like protein
NoteTssM
UniProt IDB7LTR4
KEGG IDefe:EFER_1964
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.00E-83, Aligned region: 505..818
ImcF-related_N [PF14331], Evalue: 8.00E-62, Aligned region: 204..454
DUF1215 [PF06744], Evalue: 3.10E-33, Aligned region: 304..321
DUF1215 [PF06744], Evalue: 3.10E-33, Aligned region: 914..1032
AAA_22 [PF13401], Evalue: 0.0019, Aligned region: 140..271
AAA_22 [PF13401], Evalue: 0.0019, Aligned region: 661..683
AAA_22 [PF13401], Evalue: 0.0019, Aligned region: 855..887
Protein Sequence: 1173 a.a.     [Download]
>gi|218549302|ref|YP_002383093.1| IcmF-like protein [Escherichia fergusonii ATCC 35469]
MFRLPTPRLFSGLKSVLRPAMPRFKVSAFWLLILAWIFLLVWIWWKGPTWTLYEEQWLKPLANRWLATAA
WGIIALVWLTVRVMKRLQQLEKQQKQQREEAVDPLSVELNAQQRYLDRWLLRLQRHLDNRRYLWQLPWYM
VIGPAGSGKTTLLREGFPSDIIYTPEAVRGAEPRLYLIPHVGQQAVIFDIDGSLCEQPDANVLHRRLWEH
TLGWLVEKRARQPLNGLILTLDLPDLLTADKRRREYLLQTLRSRLQDVRQQLHCQLPVYVVLTRLDLLHG
FATLFQSLDKKDRDTILGVTFTRRAHENEDWRSELNAFWQSWCDRMNQALPDLMLAQSHMRGSLFSFARQ
MQGSQESLVALLDGLLDGENMDVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGSSPLTAWPLVDTTPYF
TRNLFPQALLAEPNLATESRTWLTSSRRRLTIFSATGGVAALLLITGWHHYYNDNYTSGVQVLKQAKAFM
DITPPQGMDDYGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRVGPYVEQTYLQLLEQRYLPALF
NGLVKEMNTAPPESEEKLAVLRVIRMLEDKSGRNNEVVKQYMAKRWSEKFHGQRDIQAQLMSHLDYALAH
TDWHAERQAGDSDAINRWIPYDKSVVSAQKELSKLSVYQRVYQSLKTRALGVLPADLNLRDQVGPTFEQV
FTSADDNKLVVPQFLTRYGLQRYFVKQRDELVELTALDSWVLNITHNVKYSDADRTEIQRQLTEQYLSDY
TATWRAGMDNLNVRNYVSIAQLTSALEQIISGDQPLQRALTALRDNTQPAVLSEKISDKERENALAEPDF
RLLTRLGHEFAPENSTLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPI
FATRQMAKTLPAPLNRWVGKLADQAWHVVMVEAVHYMEIDWRDNVVKPFNEQLAGNYPFNPRSAQDASLD
AFERFFKPDGVLDTFWQQNLKLFIENDLSRDGDNGVIIREDIIRQLDTAQKIRDIFFSKQNGLGTQFAVE
TVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGVSGGAPRSIRFTGPWAQFRL
FGAGQLTSVEAGTFSVRFNVDGGAMVYRIHADTEDNPFSGGLFSQFRLSDTLY
 
Nucleotide Sequence: 3522 bp     [Download]
>ref|NC_011740.1|:c2013862-2010341 IcmF-like protein [Escherichia fergusonii ATCC 35469]
GTGTTCAGATTACCAACACCCCGACTATTCAGCGGACTCAAATCAGTCCTGCGCCCGGCGATGCCCCGGT
TTAAGGTTTCTGCATTCTGGCTGCTGATACTGGCGTGGATTTTCCTGCTGGTGTGGATCTGGTGGAAAGG
CCCGACGTGGACGCTGTATGAAGAACAGTGGCTCAAACCACTGGCTAACCGCTGGCTGGCAACGGCAGCA
TGGGGGATTATTGCCCTGGTGTGGCTTACTGTCCGGGTAATGAAGCGCCTGCAACAGCTTGAAAAACAGC
AAAAACAGCAGCGCGAAGAGGCCGTTGATCCGCTCAGCGTGGAGCTGAACGCCCAGCAGCGTTACCTCGA
CCGCTGGTTACTGCGCCTGCAACGCCATCTCGACAACCGCCGCTACCTGTGGCAGTTGCCCTGGTATATG
GTTATCGGTCCGGCGGGCAGTGGCAAAACGACACTGCTGCGCGAGGGTTTTCCGTCTGACATAATTTATA
CCCCCGAAGCGGTGCGTGGGGCGGAGCCGCGCCTGTATCTCATCCCGCATGTCGGGCAACAGGCGGTGAT
ATTCGATATTGATGGCTCGCTCTGTGAACAGCCGGATGCAAATGTGTTGCACCGCCGGTTATGGGAACAT
ACCCTGGGCTGGCTGGTAGAGAAGCGCGCCCGTCAGCCGCTGAACGGACTCATTTTGACCCTCGATTTAC
CTGACCTGCTGACCGCCGACAAGCGCCGCCGTGAGTATCTGCTACAGACGCTGCGCAGCCGCCTCCAGGA
TGTACGCCAGCAGCTTCACTGCCAGTTGCCGGTCTATGTGGTGCTGACCCGGCTGGATCTGCTGCATGGT
TTTGCCACGCTGTTTCAGTCACTGGATAAAAAAGATCGTGACACCATTCTGGGCGTCACGTTCACCCGTC
GTGCCCATGAAAACGAGGACTGGCGAAGCGAACTTAATGCCTTCTGGCAGTCGTGGTGTGACCGAATGAA
CCAGGCGCTGCCGGATCTGATGCTGGCGCAGAGCCATATGCGTGGCTCCCTGTTTAGCTTTGCCCGCCAG
ATGCAGGGAAGCCAGGAATCCCTGGTGGCGCTGCTGGATGGATTGCTGGATGGGGAAAACATGGATGTCA
TGCTGCGCGGGGTCTATCTCACCTCGTCCCTGCAACGCGGCCAGATGGATGACATCTTTACTCAGTCCGC
AGCTCGCCAGTACCGGCTGGGCAGCAGCCCGCTGACGGCCTGGCCGCTGGTGGATACCACGCCGTATTTC
ACCCGCAACCTGTTTCCGCAGGCATTACTGGCAGAGCCTAACCTGGCAACGGAGAGCCGGACCTGGCTGA
CCAGCAGTCGTCGCCGCCTGACCATCTTTTCCGCAACGGGCGGCGTGGCGGCGCTGCTGTTAATCACTGG
CTGGCACCATTATTACAATGACAACTATACCTCCGGCGTCCAGGTGCTGAAGCAGGCTAAAGCGTTTATG
GATATCACGCCCCCGCAGGGGATGGATGACTATGGCAACCTGCAACTGCCGCTGCTGAACCCGGTACGTG
ATGCCACTCTCGCCTATGGTGACTGGGGCGACCGAAGCCGCCTGGCGGATATGGGGTTATACCAGGGGCG
GCGTGTCGGGCCGTATGTGGAGCAGACCTACCTGCAATTGCTGGAGCAGCGTTATTTGCCCGCCCTGTTT
AACGGGCTGGTGAAAGAGATGAACACCGCGCCGCCAGAGAGCGAGGAAAAACTCGCTGTGCTGCGCGTGA
TACGAATGCTGGAGGATAAAAGCGGACGCAATAATGAGGTGGTGAAGCAGTATATGGCGAAACGCTGGAG
CGAAAAGTTCCACGGCCAGCGCGATATCCAGGCGCAACTGATGTCCCATCTTGATTACGCGCTGGCGCAC
ACGGACTGGCACGCAGAGCGTCAGGCGGGAGACAGTGATGCCATCAACCGCTGGATACCTTATGACAAGT
CAGTTGTGTCAGCACAGAAAGAACTTAGCAAACTGTCGGTTTACCAGCGGGTTTACCAGAGTCTGAAAAC
GCGGGCGCTGGGCGTACTGCCAGCAGATCTTAACCTGCGCGACCAGGTGGGGCCGACCTTTGAGCAGGTG
TTCACATCTGCCGATGACAACAAACTGGTTGTTCCGCAGTTTCTCACCCGTTACGGCCTGCAACGCTACT
TTGTGAAGCAGCGCGATGAACTGGTGGAACTGACCGCGCTGGACTCCTGGGTACTGAACATCACTCATAA
CGTGAAGTACAGCGACGCTGACCGGACAGAGATTCAGCGTCAGTTGACTGAACAGTATCTCAGTGACTAC
ACCGCTACCTGGCGGGCCGGGATGGATAATCTTAACGTCAGGAATTATGTGTCCATTGCGCAACTGACCA
GTGCGCTGGAGCAGATAATCAGCGGTGACCAGCCACTTCAGCGAGCGCTGACTGCCCTGCGTGATAACAC
GCAGCCTGCGGTACTCTCTGAAAAAATTTCTGATAAAGAACGGGAGAATGCACTGGCGGAGCCGGACTTC
CGCCTGCTGACCCGCCTCGGGCATGAATTCGCCCCGGAAAACAGCACGCTCGCGGTACAGAAGGATAAAG
AAAGTACCATGCAGGCGGTGTACCAGCAGTTAACGGAACTGCACCGCTATCTGCTGGCGATCCAGAACGC
GCCGGTGCCGGGGAAATCGGCGCTGAAAGCTGTCCAGCTACGTCTGGACCAGAACAGCAGCGACCCGATA
TTCGCCACCCGCCAGATGGCGAAAACCCTGCCCGCGCCACTTAACCGCTGGGTGGGCAAGCTGGCCGACC
AGGCCTGGCATGTGGTGATGGTGGAGGCCGTTCACTATATGGAAATTGACTGGCGTGACAACGTGGTGAA
ACCGTTCAATGAACAGCTTGCCGGTAACTATCCGTTTAATCCGCGCTCGGCGCAGGATGCTTCACTGGAT
GCGTTTGAACGTTTCTTTAAACCGGATGGCGTGCTGGACACATTCTGGCAGCAGAATCTGAAACTGTTTA
TTGAAAATGACCTGAGCCGTGATGGCGATAACGGGGTGATTATCCGCGAGGACATCATCCGGCAACTGGA
TACTGCACAGAAGATTCGCGACATCTTCTTCAGTAAACAAAACGGCCTGGGAACGCAGTTTGCGGTGGAA
ACGGTATCGCTCTCCGGCAATAAACGCCGCAGCGTGCTGAACCTCGATGGTCAGTTAGTCGATTACAGCC
AGGGCCGCAACTATACCGCCCACCTGGTCTGGCCGAACAACATGCGGGAAGGCAATGAAAGCAAACTGAC
GCTGATAGGCGTCAGTGGCGGAGCGCCGCGCAGTATCCGTTTCACCGGGCCGTGGGCGCAGTTCCGCCTG
TTCGGGGCAGGGCAGTTAACCAGCGTTGAGGCAGGGACATTCAGCGTGCGGTTTAACGTGGACGGTGGCG
CGATGGTCTACCGGATACACGCTGACACCGAGGACAATCCATTCAGTGGCGGGCTTTTCAGCCAGTTCAG
GCTGTCGGACACGCTGTACTGA
 Primer design