SecReT6
Protein ID: 218552795
SecReT6 ID315
T6SS typei1
Gene symbol-
Locus tagECIAI1_0229
StrainEscherichia coli IAI1
Repliconchromosome [GenBank: NC_011741] [Browse all T6SS(s) in this replicon]
Location [Strand]241152..244676 [-]
ProductIcmF-like protein
NoteTssM
UniProt IDB7M219
KEGG IDecr:ECIAI1_0229
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.30E-85, Aligned region: 323..364
IcmF-related [PF06761], Evalue: 6.30E-85, Aligned region: 505..818
ImcF-related_N [PF14331], Evalue: 1.50E-62, Aligned region: 205..455
DUF1215 [PF06744], Evalue: 3.90E-34, Aligned region: 304..322
DUF1215 [PF06744], Evalue: 3.90E-34, Aligned region: 914..1033
AAA_22 [PF13401], Evalue: 0.00018, Aligned region: 140..273
AAA_22 [PF13401], Evalue: 0.00018, Aligned region: 856..887
AAA_16 [PF13191], Evalue: 0.0089, Aligned region: 136..155
AAA_16 [PF13191], Evalue: 0.0089, Aligned region: 246..257
AAA_16 [PF13191], Evalue: 0.0089, Aligned region: 841..945
Protein Sequence: 1174 a.a.     [Download]
>gi|218552795|ref|YP_002385708.1| IcmF-like protein [Escherichia coli IAI1]
MFRLPTPRLLSGLKSALRPAMPRFKVSAFWLLILAWIFLLVWIWWKGPTWTLYEEQWLKPLANRWLATAA
WGIIALMWLTVRVMKRLQQLEKMQKQQREEAVDPLSVELNAQQRYLDRWLLRLQRHLDNRRFLWQLPWYM
VIGPAGSGKTTLLREGFPSDIIYAPEGARGAEQRLYLTPHVGKQAVIFDIDGTLCAPADADILHRRLWEH
ALGWLKEKRARQPLNGIILTLDLPDLLTADKRRREHLLQALRSRLQDIRQHLHCQLPVYVVLTRLDLLQG
FAALFQSLNRQDRDAILGVTFTRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVAQTHTRASLFSFSRQ
MQGSREPLVSLLEGLLDGENMNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYF
TRSLFPQALLAEPNLATESRAWLIRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKAFM
DVPPPQGEDDFGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIGPYVEQTYLQLLEQRYLPSLF
NGLVKELNAAPPESEEKLAVLRVMRMLEDKSGRNNQVVKQYMAKRWSEKFHGQRDIQAQLMSHLDYALAH
TDWHAERQAGDGDAISRWTPYDKPVVSAQKELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQV
FTSADDNKLVVPQFLTRYGLQSYFVKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDY
TATWRAGMDNLNIRNFESIGQLTGALEQVISGDQPLQRALTVLRDNTQPGVFSEKLSAKEREEALAEPDY
QLLTRLGHEFAPENSTLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPI
FATRQMAKTLPAPLNRWVGRLADQAWHVVMVEAVHYMEVDWRDSVVKPFNEQLANNYPFNPRSAQDASLD
AFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNNVIIREDIIAQLETAQKIRDIFFSKQNGLGTSFAV
ETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFR
LFGAGQLTGVQDGNFTVRFSVDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY
 
Nucleotide Sequence: 3525 bp     [Download]
>ref|NC_011741.1|:c244676-241152 IcmF-like protein [Escherichia coli IAI1]
GTGTTCAGATTACCAACACCCCGACTACTCAGCGGACTCAAATCAGCCCTGCGACCGGCGATGCCCCGGT
TTAAAGTCTCTGCTTTCTGGCTGCTGATACTGGCGTGGATTTTTCTGCTGGTGTGGATCTGGTGGAAAGG
CCCGACGTGGACGCTGTATGAAGAACAGTGGCTCAAACCACTGGCGAACCGCTGGCTGGCAACGGCGGCG
TGGGGGATTATTGCCCTGATGTGGCTTACCGTCCGGGTGATGAAGCGCCTGCAACAGCTTGAAAAAATGC
AAAAGCAACAGCGCGAGGAAGCCGTTGATCCGCTCAGCGTGGAACTGAACGCCCAGCAGCGTTATCTTGA
CCGCTGGCTGCTGCGCCTGCAACGCCATCTCGACAACCGCCGTTTCCTGTGGCAGTTGCCGTGGTATATG
GTCATCGGCCCGGCGGGCAGTGGCAAAACGACACTGCTGCGCGAGGGGTTTCCGTCCGACATTATTTATG
CCCCGGAGGGCGCACGCGGCGCAGAACAACGCCTGTACCTCACGCCCCATGTCGGTAAACAGGCGGTGAT
CTTTGATATCGACGGCACACTCTGCGCTCCCGCTGATGCGGATATCCTGCATCGCCGTCTGTGGGAACAT
GCCCTCGGCTGGCTGAAAGAAAAGCGCGCGCGCCAGCCGCTGAATGGGATTATTCTGACACTCGATTTAC
CCGATCTGCTTACCGCAGACAAACGCCGCCGCGAGCATCTGTTACAGGCGCTGCGCAGCCGCTTGCAGGA
TATACGCCAGCATCTTCACTGCCAGTTACCGGTTTACGTGGTACTTACCCGGCTTGATTTATTGCAGGGT
TTTGCCGCCCTGTTTCAGTCCCTGAACAGACAGGATCGCGATGCGATTCTGGGCGTCACGTTCACCCGCC
GTGCCCATGAAAATGATGACTGGCGAACAGAGTTGAATGCTTTCTGGCAGACATGGGTGGATCGAATGAA
TCTGGCGTTGCCGGATCTGATGGTCGCTCAGACTCACACCCGCGCGTCTTTATTCAGTTTTTCCCGCCAG
ATGCAGGGAAGCCGTGAACCGCTGGTGTCACTGCTTGAGGGTCTGCTTGATGGCGAAAATATGAACGTGA
TGCTGCGTGGTGTCTATCTCACCTCTTCGCTTCAGCGTGGACAGATGGATGATATATTCACCCAGTCTGC
CGCCCGCCAGTACCGGCTGGGCAATAACCCACTGGCGTCCTGGCCCCTGGTGGACACCGCGCCTTATTTC
ACCCGCAGCCTGTTCCCGCAGGCATTACTCGCAGAGCCTAATCTGGCAACAGAGAGCCGCGCCTGGCTGA
TACGTTCCCGTCGCCGCCTGACGGTTTTCTCTGCCACAGGCGGCGTGGCAGCACTGCTGCTCATCACCGG
CTGGCATCACTATTACAACGGTAACTATCAGTCTGGCATCACCGTGCTTAAGCAGGCCAAAGCCTTTATG
GACGTGCCGCCTCCGCAGGGGGAAGATGACTTTGGCAACCTGCAACTGCCGCTCCTGAACCCGGTACGCG
ATGCCACACTGGCCTATGGCGACTGGGGCGACCGCAGCCGTCTGGCCGATATGGGACTGTACCAGGGACG
ACGTATCGGGCCTTATGTGGAACAGACCTATCTGCAACTGCTGGAGCAACGTTACCTGCCCTCGCTGTTT
AACGGGCTGGTCAAAGAGCTGAACGCCGCGCCGCCGGAGAGTGAAGAAAAACTCGCGGTGCTGCGCGTGA
TGCGAATGCTGGAGGACAAAAGCGGACGTAACAATCAGGTGGTGAAGCAGTATATGGCAAAACGCTGGAG
CGAAAAGTTCCACGGTCAGCGCGATATCCAGGCACAACTGATGTCCCATCTTGACTACGCGCTGGCTCAT
ACTGACTGGCACGCAGAGCGTCAGGCGGGCGACGGTGACGCCATCAGCCGCTGGACGCCATATGACAAGC
CCGTGGTATCAGCACAGAAAGAACTGAGCAAACTGCCTGTCTACCAGCGGGTTTACCAGAGCCTGAAAAC
GCGGGCGCTGGGCGTTCTTCCTGCCGACCTCAATCTGCGTGACCAGGTAGGGCCAACCTTTGACCAGGTG
TTTACATCTGCCGATGACAACAAACTGGTTGTTCCACAGTTTCTTACCCGTTACGGCCTGCAAAGCTATT
TTGTAAAACAGCGCGATGAACTGGTTGAACTGACGGCGATGGATTCCTGGGTACTTAACCTTACCCGCAG
CGTGAAATACAGTGACGCCGACCGCGCGGAAATCCAGCGCCAGTTGACCGAGCAGTATATCAGCGACTAC
ACCGCCACCTGGCGGGCCGGGATGGACAATCTGAATATCCGCAATTTTGAGTCCATCGGACAACTGACCG
GGGCGCTGGAGCAGGTTATCAGCGGCGACCAGCCTTTGCAGCGGGCGCTAACCGTGCTGCGTGACAACAC
ACAGCCAGGCGTCTTTTCTGAAAAACTCTCTGCCAAAGAACGGGAGGAAGCCCTGGCAGAGCCGGATTAC
CAGTTACTCACCCGCCTCGGGCATGAATTCGCCCCGGAAAACAGTACCCTGGCAGTACAGAAAGACAAAG
AAAGCACGATGCAGGCCGTGTATCAGCAACTCACCGAGTTGCACCGCTACCTGCTGGCAATCCAGAACGC
GCCTGTACCAGGAAAATCGGCGCTGAAAGCCGTGCAGTTACGGCTTGATCAGAACAGCAGCGATCCGATA
TTCGCCACCCGCCAGATGGCAAAAACGCTGCCTGCTCCGCTCAACCGCTGGGTTGGCAGGCTGGCTGACC
AGGCCTGGCATGTGGTGATGGTGGAGGCTGTTCATTATATGGAAGTGGACTGGCGCGACAGCGTGGTGAA
ACCGTTTAACGAGCAACTGGCAAATAACTATCCGTTTAATCCGCGTTCTGCACAGGATGCCTCACTGGAT
GCCTTCGAACGCTTCTTTAAACCGGATGGCATACTGGATACCTTCTACCAGCAGAACCTGAAGCTGTTTA
TCGATAATGACCTGAGTCTGGAGGATGGCGATAACAACGTCATTATTCGCGAAGATATTATTGCGCAACT
GGAAACTGCGCAGAAAATCCGTGACATCTTCTTCAGCAAACAGAACGGTCTGGGAACATCCTTTGCCGTG
GAAACGGTATCGCTTTCAGGCAATAAACGCCGCAGTGTACTGAACCTTGACGGTCAGTTAGTCGATTACA
GCCAGGGCCGTAACTATACCGCCCATCTGGTCTGGCCTAACAACATGCGCGAAGGCAACGAAAGTAAGCT
GACGCTCATCGGCACCAGCGGCAACGCGCCGCGCAGTATCAGCTTCAGCGGGCCGTGGGCGCAGTTCCGC
CTGTTCGGGGCCGGACAACTGACCGGAGTACAGGATGGCAACTTTACCGTGCGCTTTAGCGTGGACGGTG
GCGCGATGACCTACCGTGTGCATACCGACACGGAAGATAACCCGTTCAGCGGTGGGTTGTTCAGCCAGTT
TGGTCTGTCAGACACACTGTACTGA
 Primer design