SecReT6
Protein ID: 218676752
SecReT6 ID318
T6SS typei1
Gene symbol-
Locus tagVS_II0991
StrainVibrio splendidus LGP32
Repliconchromosome II [GenBank: NC_011744] [Browse all T6SS(s) in this replicon]
Location [Strand]1094925..1098317 [+]
ProductIcmF-related protein
NoteTssM
UniProt IDB7VTS8
KEGG IDvsp:VS_II0991
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.10E-54, Aligned region: 153..409
IcmF-related [PF06761], Evalue: 5.60E-49, Aligned region: 501..756
DUF1215 [PF06744], Evalue: 2.80E-29, Aligned region: 867..988
Protein Sequence: 1130 a.a.     [Download]
>gi|218676752|ref|YP_002395571.1| IcmF-related protein [Vibrio splendidus LGP32]
MLKHKLMRNPVVISTVVFLFLAATIAATYILWLDITDKFYLWVALGAVTLIYSLFQVTLWLKKKNNTKAL
KLETEEEALAMVMRPLLCRSNKKPIYLMIGNKHAGRTQFLLNSSAIKPMDQTRTAKNDFFEWYESDSAVY
IKPAQRLLFQEVSSNDSALWNAFVDEVITHKPRKPFSGCLFFIDFEFLIISESEQIDYTLTALNHRLESV
SDKTSSAIPLYLMMSKLDKLEGFKEYIHFSSLKTSVEFLSIPLKEAKGVFVEYYHDSFRNLVKVMESNAL
DSSSHSHDVNEKQAILAFPKQFELCQTEIASVIERLSELNTGSYSLDIREVFFISNIQGGRKYNLLAKSC
SNYFNLPIIASEHTQLTETPYFTRFLMDSQILPESDFAGENKTYLRMIQRQSRFAVAVSIILLASGVYLF
STTLNSNLRVISQLIGIDDSQSLIQRDKSFDNSLENAIQIIQPSYQAWLSGSHALDSELLNLNVSRLDES
TKIAYNALITQIRTHLMPAIEQGYRLQLTHNQDNVNNALPLLKGYLMLNDPSKREAKFLRQQTMSILEKL
STQPETIASVMKYLDAYLRTNFEPVSINMNIVRATRRSLLSHSNVDLVYASLLQQAGDIDLGTLNLQRAV
GFDFNNVFNDNLDPARLEIDKVYTSTGFSTFYRPRVDLMSQQVITDNWVLGLSNHVIPTDKEQESFKRLV
RKKYTDDYISYWRNALSELKVKRYNNVGELTNAIDLISGPSSPMTTILKQVYTNTQFSPIGQQSILMAKV
NPKLAGAVKAAPDLVEEMVQPDYLLMKRVEQAFHILNQLQINETPNSPTPWDETITALSRVRTYMKDIAD
APDPQMAALSAAQHRMESTEADPIIRLKQIAQKSPEPVRSWLLDVVNQSWSVMISESSKGIQTLWYSEIY
SKFKDLGLGKYPFDLSATEEISIDDFELLFAPGGLLDAFIVKNFAPFYDTNLWTPKQVEGETMPLSPELL
VQLRNYNVIRDTLINKSTNRLYLPFSAKVLDLDSSAIRASLKIADSNINYYHGPSRIRELEWPPQNGDFN
ISITIQDVTDEGKQHVLSKNGQWAIYRLFGDSTLTNTHNGSFVSDIKVSGRDLSLRITPLTQRNPFTLAE
LYNFTLPEAI
 
Nucleotide Sequence: 3393 bp     [Download]
>gi|294510242|ref|NC_011744.2|:1094925-1098317 Vibrio splendidus LGP32 chromosome 2, complete sequence
ATGTTAAAACACAAACTAATGAGAAACCCTGTTGTTATATCAACGGTGGTTTTTCTCTTTCTTGCAGCTA
CAATCGCTGCTACTTATATCCTTTGGCTAGATATAACAGACAAGTTTTATCTTTGGGTTGCTTTAGGCGC
TGTCACACTTATCTATTCGTTGTTTCAGGTGACACTGTGGCTTAAGAAAAAAAACAACACTAAAGCCTTA
AAACTTGAAACAGAGGAAGAAGCTCTAGCTATGGTAATGCGCCCTCTTCTTTGTCGTTCAAACAAAAAGC
CAATATATTTGATGATTGGCAATAAACATGCGGGTCGAACTCAGTTCCTACTTAACTCTAGTGCGATCAA
ACCGATGGATCAAACTCGTACCGCAAAGAATGATTTTTTCGAATGGTATGAGTCTGACTCGGCTGTATAT
ATCAAACCGGCTCAACGACTGTTATTTCAAGAAGTATCAAGTAATGACAGCGCTTTATGGAATGCGTTTG
TAGATGAAGTCATTACACATAAACCAAGAAAGCCATTTTCTGGTTGTCTATTCTTTATTGATTTTGAATT
TCTAATTATCTCTGAATCGGAACAAATAGATTACACATTAACAGCTCTTAACCATCGATTAGAATCAGTA
AGTGACAAAACATCATCAGCAATCCCTCTTTATCTAATGATGTCTAAGCTCGATAAACTAGAAGGTTTTA
AGGAGTACATTCACTTTAGCTCCCTAAAAACATCGGTCGAGTTTCTATCAATCCCATTGAAGGAAGCTAA
AGGAGTATTCGTTGAATACTATCACGACAGTTTTCGAAATTTAGTCAAAGTGATGGAGAGTAATGCACTG
GATTCATCTTCCCACTCTCACGACGTAAATGAAAAGCAAGCTATATTAGCTTTCCCTAAACAGTTTGAGT
TATGTCAAACTGAGATCGCATCAGTAATAGAGCGACTTTCAGAACTGAATACTGGGTCCTATTCACTTGA
TATCCGCGAAGTGTTTTTTATATCGAATATCCAAGGTGGTAGAAAATACAACCTATTGGCAAAGAGCTGT
AGTAACTACTTCAATTTGCCGATCATTGCTTCAGAACATACACAGTTGACTGAAACGCCCTATTTCACTC
GCTTCTTGATGGACTCTCAAATCCTCCCAGAATCGGACTTTGCAGGCGAAAACAAAACTTATCTTAGAAT
GATCCAGCGACAAAGTCGCTTTGCTGTTGCTGTTTCTATCATTTTGCTTGCGAGTGGCGTTTACCTCTTT
TCAACGACTTTGAATAGCAATTTAAGAGTGATTAGCCAACTCATTGGGATTGACGACTCACAATCTCTAA
TTCAAAGAGATAAATCTTTTGATAACTCACTTGAAAATGCAATCCAAATCATACAACCATCTTATCAAGC
ATGGCTTAGTGGATCTCATGCATTAGATAGTGAACTTTTAAACCTAAACGTTAGCCGTCTCGATGAAAGC
ACAAAAATCGCTTACAACGCCCTGATCACGCAAATTAGAACGCACCTAATGCCAGCAATTGAACAGGGAT
ATCGTTTACAGCTAACACATAACCAAGACAATGTTAACAATGCGCTGCCTTTGCTCAAAGGCTACTTAAT
GTTAAATGACCCAAGCAAGCGAGAGGCAAAATTTCTACGTCAACAAACAATGTCAATACTAGAAAAGCTA
AGCACTCAACCTGAAACGATTGCTAGCGTAATGAAGTATTTAGACGCCTATCTCCGCACGAATTTTGAGC
CGGTATCAATAAACATGAATATTGTTCGCGCGACAAGACGATCGTTGCTTTCTCATTCAAACGTAGATTT
GGTTTATGCTAGCTTATTACAACAAGCTGGTGATATCGATTTAGGCACTTTGAACCTACAACGAGCGGTT
GGTTTTGACTTCAACAATGTTTTCAACGATAACTTAGATCCTGCACGGTTAGAGATCGATAAAGTTTATA
CGTCAACAGGTTTCAGTACTTTTTATCGCCCTCGCGTCGATTTAATGTCTCAACAGGTTATCACTGATAA
TTGGGTTCTTGGCCTATCAAACCACGTGATTCCTACTGACAAAGAGCAAGAAAGTTTCAAGAGACTAGTA
AGGAAGAAATATACCGATGATTACATTAGTTATTGGCGAAATGCTTTGAGCGAGTTAAAAGTAAAACGTT
ACAACAATGTAGGGGAATTGACTAACGCTATTGATCTAATTTCCGGGCCATCTTCCCCAATGACAACCAT
TTTAAAACAAGTTTATACAAACACACAATTTTCACCTATAGGCCAACAAAGCATTTTGATGGCCAAGGTT
AACCCAAAACTTGCCGGAGCGGTAAAAGCGGCTCCGGATCTCGTTGAAGAAATGGTACAACCCGATTACT
TATTAATGAAAAGGGTTGAACAGGCATTTCATATCCTGAATCAGCTGCAGATCAATGAAACTCCAAACTC
TCCCACTCCATGGGATGAGACGATAACCGCGCTGAGTCGAGTTCGAACTTATATGAAGGATATTGCTGAC
GCACCAGATCCTCAAATGGCCGCGCTGTCAGCAGCGCAACATAGAATGGAGAGTACTGAGGCAGATCCTA
TTATTCGTTTAAAACAGATCGCTCAAAAATCTCCTGAGCCAGTAAGAAGTTGGCTTTTAGACGTAGTTAA
CCAGAGCTGGTCCGTGATGATTTCTGAATCATCAAAAGGAATACAAACTCTTTGGTATAGTGAAATATAC
AGCAAATTCAAAGACTTAGGATTAGGGAAGTATCCTTTCGATTTAAGTGCAACTGAAGAAATTTCAATCG
ATGACTTTGAACTTTTATTTGCACCAGGAGGGTTACTAGATGCATTCATCGTCAAAAACTTCGCACCTTT
TTACGACACAAACCTATGGACACCAAAACAAGTAGAAGGTGAAACGATGCCGCTCTCACCTGAGTTACTC
GTTCAGCTTAGAAATTATAATGTAATTAGAGATACGCTAATCAATAAAAGCACAAACCGACTGTATCTTC
CTTTTAGCGCAAAAGTACTTGACCTGGACTCTAGTGCAATCAGAGCAAGCTTGAAGATAGCAGACTCAAA
TATCAATTATTACCATGGCCCTAGCAGAATTCGAGAACTCGAATGGCCTCCTCAAAATGGAGACTTCAAT
ATAAGCATCACAATACAAGACGTAACAGACGAGGGGAAACAACACGTACTGAGTAAAAATGGTCAATGGG
CTATCTATAGACTATTTGGAGATTCTACGTTGACAAATACCCACAACGGCAGCTTCGTGAGTGATATAAA
AGTATCAGGCAGAGACCTAAGCTTACGAATTACCCCTTTAACTCAGAGAAATCCGTTTACGTTGGCGGAG
CTATATAACTTCACTCTACCTGAAGCTATATAA
 Primer design