SecReT6
Protein ID: 218696586
SecReT6 ID321
T6SS typei4b
Gene symbol-
Locus tagEC55989_3284
StrainEscherichia coli 55989
Repliconchromosome [GenBank: NC_011748] [Browse all T6SS(s) in this replicon]
Location [Strand]3371784..3375197 [-]
Producthypothetical protein
NoteTssM
UniProt IDB7LFP6
KEGG IDeck:EC55989_3284
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-13, Aligned region: 180..341
Protein Sequence: 1137 a.a.     [Download]
>gi|218696586|ref|YP_002404253.1| hypothetical protein EC55989_3284 [Escherichia coli 55989]
MIFMLKKTFSLFLWFFVSVFVLSVCYVIGVFRNWTDTTTALYWISVILVTLSFKFIMDCIHNYFSAGKYR
NFLKSFSRKKRALTLDSYFKKGLNIISKRGRGEVPWFLLTGDSEKNNSLLEDINLPVFHRNCVNSTPQQF
RTIRWWFFRDLSVLELSGKIYDNPGVINSVISSLSARKCKKQPPRGVVLVISADKLINHDYTYIRTLSQK
TRSFVEQLSLHLHHNIPVFIVISGCEHISGYSVLAQKIYQKHEKWHPVFWATNKSGTNASEYDSSYILSS
LRSNIMASICHALDDSLSDKEKNDILQFPDRLKGLKYSLDIFISTFCIENVFFSQTEIAGICLSGELMGE
KDKNCIFADILISEILPQIHDSDVIHVNKQRVNVSFKSVIAMTALCFVGYSGYCSYNVYNIRHGSVDTSH
AFLTEQISKYEDKVRSNMRYFPFKPALDDKYLFFRESLHKTTRFDISPVSWRVTEYKKNFMQASPSGKRE
LILSLSSSLISWDKMMKDESLSDLAKSPGIHELLKITRPHDKISSIASLAVERDEIQKNNGIENIYVFRN
LLTELVQSDPSYSWFVSEDVNIPAVRITDFWEDENSSVYLSGIWTQPGQNKLHQWYETIKEAYGRDTVPE
AFSSFVLYLDESRQEHFRQFIMSVARVRKDSHSGLMNPLQLTNIIHNRSSEHRFFQFVDDELHNIPTSSA
QDWLSEFRLLNHLFSLKVDNGMKRQIEQFDLMLRIYLISVLNNSQMNRTLTHVTTWRSWQNALRNAVNSV
LHTASSVELIRNAMRSDPENKLVILFDEFEKVRSVINSNNREPVIDSVWDIYERQIYQLLDHAVTYTGCW
VGEQWRNSVLGRFNSGKHNLSYSEMQGKVYKDIIGFLKGPSNGVLALDPDGVRLLSFRERSIPFSPSFIT
FINDIVSPDDLLDVWLRERTQNKDELINVQGQLDLLNQTLQNAESQPYRVTIDSAPATIPDNPRVKPTGT
TLTLECKTGNSSIRSMNFADSGIFTWYPGSCHSVRIDILFPNFSATYKFTGETAWIDFINKFSDGESELM
TKDFSPESRNFLESMGIKGILVRYKLSDTGNLSQAYIEWEQLKQEKDKLKDLQVNLSNKLLTTHSWEKSA
WISRLPGNITICPVVQE
 
Nucleotide Sequence: 3414 bp     [Download]
>gi|218693476|ref|NC_011748.1|:c3375197-3371784 Escherichia coli 55989 chromosome, complete genome
ATGATTTTTATGCTTAAGAAGACATTTTCATTATTTCTCTGGTTTTTTGTTTCTGTCTTCGTTCTGTCTG
TTTGCTATGTTATCGGCGTGTTCAGAAACTGGACAGATACTACAACTGCACTTTACTGGATTTCTGTGAT
TCTTGTTACTCTTTCCTTTAAATTTATTATGGATTGTATCCATAATTACTTTTCTGCAGGAAAATACAGA
AATTTTCTAAAGTCTTTCTCTCGTAAAAAGAGAGCATTGACGCTTGATTCGTATTTCAAAAAAGGTCTGA
ATATCATAAGTAAAAGGGGAAGAGGAGAGGTTCCTTGGTTCTTACTTACGGGAGATTCAGAAAAAAACAA
CTCTTTGCTTGAAGATATCAATCTTCCTGTCTTTCACCGTAATTGTGTAAATAGCACTCCCCAACAATTC
CGGACAATTCGTTGGTGGTTTTTCAGAGATTTAAGCGTGCTGGAGTTGTCAGGAAAGATATATGATAACC
CGGGAGTAATAAACTCTGTGATAAGTTCTTTATCAGCACGTAAATGTAAAAAACAGCCACCTCGTGGCGT
TGTTCTCGTCATTTCTGCTGATAAGCTAATTAATCATGATTACACCTATATTCGGACATTGTCTCAAAAA
ACAAGGAGTTTTGTAGAACAACTGTCGTTACACTTACATCACAACATTCCGGTCTTTATAGTGATTAGTG
GATGTGAGCACATCAGTGGATATTCAGTGCTGGCACAAAAAATCTATCAAAAACATGAAAAATGGCATCC
AGTGTTTTGGGCAACCAATAAATCAGGGACGAATGCATCTGAATATGATTCATCATACATATTATCATCA
TTAAGATCTAATATAATGGCATCAATATGCCATGCGCTTGATGATTCATTAAGTGACAAGGAAAAAAATG
ATATACTGCAGTTTCCTGATAGATTGAAAGGTCTAAAGTATTCACTTGACATATTTATTTCCACATTCTG
TATTGAGAACGTTTTTTTCTCTCAGACGGAAATTGCCGGGATCTGTTTATCTGGTGAACTCATGGGGGAG
AAGGACAAAAACTGTATTTTTGCTGATATCCTTATTTCCGAGATACTGCCACAAATACATGATTCAGACG
TTATTCATGTTAACAAACAAAGAGTGAATGTATCGTTTAAATCAGTTATAGCCATGACTGCATTGTGTTT
TGTTGGATATAGCGGATATTGTTCATATAATGTGTATAACATCAGACATGGTTCTGTTGATACCAGCCAT
GCATTTCTGACAGAGCAGATATCAAAATATGAAGACAAAGTTAGGTCTAACATGCGGTATTTCCCTTTTA
AGCCTGCACTAGATGATAAATATCTATTTTTCAGAGAATCTCTTCATAAAACAACAAGATTCGATATCAG
TCCTGTCTCATGGCGCGTTACTGAATATAAGAAGAATTTCATGCAAGCTTCACCATCAGGAAAGCGAGAA
CTAATTCTGTCGCTCTCATCATCACTTATCAGTTGGGATAAGATGATGAAAGATGAATCCCTGAGTGACT
TAGCAAAATCTCCTGGTATTCATGAGTTACTGAAGATAACCAGACCTCATGATAAAATATCATCAATAGC
TTCACTTGCTGTAGAAAGAGATGAGATACAGAAAAATAATGGAATTGAGAATATTTATGTGTTCAGAAAC
CTCCTGACTGAGTTGGTTCAGAGTGACCCGTCTTATTCATGGTTTGTTTCTGAAGATGTTAATATTCCTG
CTGTAAGAATTACGGACTTTTGGGAAGATGAAAACTCTTCTGTCTATCTTTCCGGAATATGGACACAACC
GGGACAGAATAAACTTCATCAGTGGTATGAGACTATCAAAGAGGCATATGGACGTGATACGGTTCCGGAG
GCGTTCTCATCCTTTGTGCTATACCTGGATGAAAGTCGTCAGGAGCATTTCAGACAGTTTATTATGTCTG
TTGCAAGGGTACGTAAAGACTCACATTCAGGTTTAATGAATCCGCTGCAACTGACCAATATTATACACAA
TCGCTCATCTGAGCATAGATTCTTTCAGTTTGTAGATGATGAATTACACAATATACCAACGAGTTCGGCG
CAGGACTGGCTTTCTGAATTCAGACTGCTTAACCATCTGTTTTCACTTAAAGTGGATAACGGAATGAAAC
GTCAAATAGAACAATTTGATCTCATGTTACGTATATACCTGATTTCTGTTCTTAATAACAGTCAAATGAA
CAGGACACTGACTCATGTTACCACATGGAGAAGCTGGCAGAATGCTCTACGTAATGCCGTGAATTCAGTG
TTACATACAGCATCATCAGTTGAACTTATTCGTAATGCCATGCGTTCAGATCCAGAAAACAAGCTGGTAA
TATTATTTGATGAGTTTGAAAAGGTTCGCTCAGTCATTAACAGCAATAATAGAGAGCCGGTGATTGATTC
TGTATGGGATATTTATGAGCGGCAGATTTATCAACTTCTCGACCATGCTGTCACTTATACAGGGTGTTGG
GTTGGTGAACAATGGAGGAATTCTGTTTTAGGCCGGTTTAACTCAGGAAAACATAATCTCAGTTATTCTG
AGATGCAGGGAAAAGTATATAAGGACATTATTGGCTTTTTGAAAGGTCCGTCTAACGGAGTTTTAGCGCT
TGATCCAGACGGTGTCAGACTGTTGTCCTTCAGGGAAAGAAGTATACCTTTTTCCCCTTCATTCATTACT
TTCATTAATGACATTGTTTCCCCGGATGATCTGCTTGATGTTTGGCTCAGAGAGCGAACGCAAAACAAGG
ATGAATTAATAAATGTACAGGGGCAACTAGACTTACTGAATCAGACCCTACAAAATGCTGAGTCACAGCC
TTACAGAGTTACGATAGATAGTGCACCTGCGACAATTCCGGATAATCCCCGAGTCAAACCAACAGGTACA
ACTCTGACTCTTGAGTGTAAAACAGGTAACAGCAGTATACGAAGTATGAATTTTGCTGATTCAGGTATTT
TTACCTGGTATCCGGGAAGCTGTCACTCTGTAAGAATTGACATTTTGTTCCCTAATTTTTCTGCCACCTA
TAAGTTTACAGGAGAAACAGCCTGGATTGATTTTATCAACAAGTTTTCGGATGGAGAGAGTGAGTTAATG
ACAAAGGATTTTTCTCCAGAATCAAGAAATTTTCTCGAATCAATGGGGATTAAAGGCATTCTTGTCCGTT
ACAAACTGAGTGATACAGGCAATCTAAGTCAGGCATATATCGAATGGGAACAACTAAAACAGGAAAAGGA
TAAACTTAAAGATTTACAGGTGAATCTGAGTAATAAGCTGCTTACCACACATAGCTGGGAGAAAAGTGCC
TGGATTTCCAGACTGCCCGGCAATATAACAATATGTCCAGTAGTACAGGAGTGA
 Primer design