SecReT6
Protein ID: 218703468
SecReT6 ID322
T6SS typei1
Gene symbol-
Locus tagECUMN_0216
StrainEscherichia coli UMN026
Repliconchromosome [GenBank: NC_011751] [Browse all T6SS(s) in this replicon]
Location [Strand]243396..246923 [-]
Producthypothetical protein
NoteTssM
UniProt IDB7N881
KEGG IDeum:ECUMN_0216
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.70E-83, Aligned region: 508..820
ImcF-related_N [PF14331], Evalue: 1.00E-60, Aligned region: 210..458
ImcF-related_N [PF14331], Evalue: 1.00E-60, Aligned region: 837..883
DUF1215 [PF06744], Evalue: 3.50E-32, Aligned region: 304..323
DUF1215 [PF06744], Evalue: 3.50E-32, Aligned region: 916..1034
Protein Sequence: 1175 a.a.     [Download]
>gi|218703468|ref|YP_002410987.1| hypothetical protein ECUMN_0216 [Escherichia coli UMN026]
MFRFPTSRLFSTLRSALRPAMPRFRVSAAWLLALAWIFLLVWIWWQGPKWTLYEQHWLAPLTNRWLATAV
WGLIALIWLTWRVMKRLQKLEKQQKQQREEEKDPLTVELHRQQQYLDHWLLRLRRHLDNRRYLWQLPWYM
VIGPAGSGKSALLREGFPSDIIYTPESIRGTEYHPLITPRVGNQAVIFDVDGVLTSPGGDDLLHRRLREH
WLGWLMQTRARQPLNGLILTLDLPDLLTADKSRRETLVQNLRQQLQEIRQSLHCRLPVYVVLTRLDLLTG
FAALFHSLDKKDRDAILGVTFTRRAHESDDWRSELGAFWQTWVQQVNLALSDLMLAQTGAAPRSAVFSFS
RQMQGTGEIVTALLAALLDGENMDVMLRGVWLTSSLQRGQVDDIFTQSAARQYGLGNSSLATWPLVETTP
YFTRRLFPEVLLAEPNLAGENSVWLNSSRRRLTAFSACGAALAALLVGSWHHYYNQNWQSGVNVLAQAKA
FMDVPPPQGTDEFGNLQLSLLNPVRDATLAYGDYRDRGFLADMGLYQGVRVGPYVEQTYIQLLEQRYLPS
LMNGLIRDLNNAPPESEEKLAVLRVLRMMEDKSGRNNEAVKQYMARRWSNEFHGQRDIQAQLMAHLDYAL
EHTDWHAQRQSGDSDAVSRWTPYDKPVINAQQELSKLPIYQRVYQTLRTKALSVLPADLNLRDQVGPTFD
NVFVAGNDEKLVIPQFLTRYGLQSYFVKQREGLVELTALDSWVLNLTQSVAYSEADREEIQRHITEQYIS
DYTATWRAGMDNLNVRDYEAMSALTDALEQIISGDQPFQRALTALRDNTHALTLSGKLDDKAREAAINEM
DYRLLSRLGHEFAPENSALEEQKDKASTLQAVYQQLTELHRYLLAIQNSPVPGKSALKAVQLRLDQYSSD
PIFATRQMAKTLPAPLNRWVGKLADQAWHVVMVEAVRYMEVDWRDNVVKPFNEQLADNYPFNPRATQDAS
LDSFERFFKPDGILDNFYKNNLRLFLENDLTFGDDGRVLIREDIRQQLDTAQKIRDIFFSQQNGLGAQFA
VETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGRAPHSIAFSGPWAQF
RLFGAGQLTNVTSDTFNVRFNVDGGAMVYRVHVDTEDNPFTGGLFSLFRLPDTLY
 
Nucleotide Sequence: 3528 bp     [Download]
>ref|NC_011751.1|:c246923-243396 hypothetical protein ECUMN_0216 [Escherichia coli UMN026]
GTGTTCAGATTTCCGACATCCCGACTGTTCAGCACGCTGAGATCTGCTCTCAGGCCAGCGATGCCGCGAT
TCAGGGTATCCGCCGCCTGGCTGCTGGCGCTGGCATGGATTTTTCTGCTGGTGTGGATCTGGTGGCAAGG
TCCGAAATGGACGCTCTATGAGCAGCACTGGCTGGCTCCTCTAACAAACCGCTGGCTGGCGACCGCCGTC
TGGGGGCTTATCGCTCTGATCTGGCTCACCTGGCGGGTAATGAAGCGTCTGCAAAAGCTGGAAAAACAGC
AGAAACAGCAGCGGGAGGAAGAAAAAGATCCGTTGACCGTGGAACTCCACCGCCAGCAGCAATATCTGGA
TCACTGGCTGCTGCGCCTGCGCCGCCATCTGGATAACCGCCGTTATCTGTGGCAGTTGCCGTGGTATATG
GTCATTGGTCCTGCGGGTAGCGGTAAAAGCGCTCTGCTGCGCGAGGGCTTTCCATCTGACATTATTTACA
CGCCGGAAAGCATCCGGGGTACGGAATACCATCCGCTGATCACACCGCGAGTGGGCAACCAAGCGGTGAT
TTTCGATGTTGACGGCGTACTGACCTCGCCCGGCGGGGATGATCTGCTCCACCGCCGCCTGCGCGAACAC
TGGCTGGGCTGGCTGATGCAAACGCGCGCGCGCCAGCCGCTCAACGGCCTGATCCTGACGCTCGATCTTC
CCGATCTGCTGACGGCGGATAAATCCCGCCGTGAGACACTGGTACAAAATTTGCGCCAGCAACTTCAGGA
GATCCGCCAGAGTCTGCACTGCCGTCTGCCCGTTTACGTGGTGCTGACACGGCTGGATCTGCTGACCGGC
TTTGCCGCGCTGTTCCATTCACTGGATAAAAAAGACCGCGATGCGATCCTCGGCGTCACGTTTACCCGCC
GCGCCCATGAAAGTGACGACTGGCGCAGCGAACTGGGGGCTTTCTGGCAGACGTGGGTACAACAGGTGAA
CCTGGCGCTGTCGGATCTGATGCTCGCACAAACCGGTGCTGCTCCCCGCAGCGCCGTGTTCAGCTTCTCC
CGTCAGATGCAGGGAACAGGAGAAATCGTCACCGCACTGCTCGCCGCATTGCTGGACGGTGAGAACATGG
ATGTAATGCTGCGTGGCGTCTGGCTCACATCATCGCTACAGCGTGGCCAGGTGGATGATATTTTCACGCA
GTCCGCCGCCCGCCAGTACGGGCTGGGTAACAGCTCGCTGGCAACCTGGCCTCTGGTGGAGACGACGCCG
TATTTTACTCGCCGCCTCTTCCCTGAAGTCCTGCTGGCTGAGCCGAACCTGGCGGGTGAAAACAGCGTCT
GGCTGAACAGCTCCCGGCGCAGGCTGACCGCCTTTTCCGCCTGTGGCGCGGCGCTGGCGGCATTGCTGGT
CGGAAGCTGGCACCATTATTACAATCAGAACTGGCAGTCCGGCGTTAACGTACTGGCACAGGCTAAAGCC
TTTATGGACGTACCACCACCGCAAGGAACGGATGAATTCGGCAATCTGCAACTGTCGTTGCTTAATCCGG
TACGCGATGCCACCCTGGCCTATGGCGATTACCGCGATCGCGGTTTTCTGGCGGATATGGGATTGTACCA
GGGCGTCCGCGTAGGGCCGTATGTGGAGCAAACCTACATTCAGCTTCTTGAGCAGCGTTATCTCCCCTCG
TTAATGAACGGCCTGATCCGGGATCTAAACAATGCCCCGCCAGAGAGCGAAGAAAAGCTCGCCGTGCTGC
GCGTACTGCGCATGATGGAAGACAAAAGTGGGCGCAACAACGAGGCGGTAAAACAGTACATGGCGCGGCG
CTGGAGCAATGAATTTCACGGCCAGCGCGATATTCAGGCGCAACTGATGGCGCATCTGGACTATGCGCTG
GAGCACACCGACTGGCACGCGCAGCGCCAGAGCGGTGACAGCGATGCTGTCAGCCGCTGGACCCCCTATG
ATAAACCGGTCATTAATGCGCAGCAGGAACTGAGCAAGCTGCCCATATACCAGCGTGTCTACCAGACCCT
GCGCACCAAAGCATTAAGCGTGTTGCCCGCCGATTTGAATTTGCGCGACCAGGTTGGTCCCACCTTCGAC
AACGTGTTCGTCGCCGGTAATGATGAAAAACTGGTGATCCCGCAGTTCCTCACCCGCTATGGACTGCAAA
GCTATTTTGTCAAACAGCGTGAGGGCCTCGTTGAGCTGACCGCGCTGGATTCGTGGGTACTGAACCTGAC
GCAAAGCGTCGCCTACAGCGAGGCCGACCGTGAAGAGATCCAGCGCCATATCACCGAACAGTACATCAGT
GACTATACCGCCACCTGGCGTGCCGGAATGGATAACCTCAACGTCCGTGACTATGAGGCCATGTCGGCGC
TGACCGACGCGCTGGAGCAGATTATCAGCGGCGATCAGCCATTCCAGCGTGCGCTGACGGCGCTGCGCGA
TAATACCCACGCGCTGACGCTCTCCGGCAAACTGGATGATAAGGCGAGGGAAGCGGCAATAAATGAGATG
GATTACCGCCTGTTATCCCGGCTGGGGCATGAGTTCGCACCGGAAAACAGCGCACTGGAGGAGCAAAAGG
ACAAGGCGAGTACGCTACAGGCCGTGTACCAGCAACTGACCGAGCTGCACCGTTACCTGCTGGCGATCCA
GAACTCGCCAGTGCCGGGGAAATCGGCGCTGAAAGCAGTACAGCTACGTCTGGATCAATACAGCAGCGAT
CCAATCTTCGCTACCCGCCAGATGGCAAAAACTCTCCCTGCACCGCTTAACCGCTGGGTAGGTAAGCTCG
CGGATCAGGCCTGGCATGTGGTGATGGTGGAAGCCGTTCGTTACATGGAAGTGGACTGGCGCGACAATGT
AGTGAAACCCTTCAACGAGCAGCTTGCCGATAACTATCCGTTTAATCCGCGCGCCACACAGGATGCCTCA
CTGGATTCGTTTGAACGTTTCTTTAAACCGGATGGCATTCTGGACAATTTCTACAAGAACAACCTGCGCC
TGTTCCTTGAAAACGATCTGACCTTTGGCGACGACGGCAGAGTGTTAATCCGTGAAGATATCCGGCAGCA
ACTGGATACCGCGCAGAAAATCCGCGACATCTTCTTCAGCCAGCAGAACGGGCTGGGCGCACAGTTTGCC
GTGGAAACCGTATCGCTTTCCGGCAATAAGCGGCGCAGCGTACTTAACCTGGACGGCCAGTTAGTGGACT
ACAGCCAGGGACGCAACTACACCGCCCATCTGGTCTGGCCGAACAACATGCGTGAAGGCAATGAAAGCAA
GCTGACGCTGATTGGCACCAGCGGCAGAGCACCGCACAGTATCGCGTTCAGTGGACCGTGGGCGCAGTTC
CGCCTGTTCGGCGCGGGCCAGTTGACCAATGTGACCAGTGACACCTTTAACGTGCGCTTTAACGTGGACG
GCGGCGCAATGGTTTACCGGGTGCATGTGGATACCGAAGATAACCCGTTCACCGGCGGTCTGTTCAGCCT
GTTCCGTTTACCGGATACGTTGTATTAA
 Primer design